From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2453 [new locus tag: NWMN_RS14100 ]
  • pan locus tag?: SAUPAN006216000
  • symbol: NWMN_2453
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2453 [new locus tag: NWMN_RS14100 ]
  • symbol: NWMN_2453
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2699302..2699469
  • length: 168
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    GTGAGATACGTTATTTCAATAATAATGGGAATTGTATTAGCAATTTGGTCATTTAAACAA
    CTGAGTCAAAGTCATTTAGATAGCGGATTTATTTTTTTCTTCATAGTTTATGTGTTGTGT
    ATCAGTTGTTTTAATAGCGATAAGCACGATAAAAATAAAAAACGATAG
    60
    120
    168

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2453 [new locus tag: NWMN_RS14100 ]
  • symbol: NWMN_2453
  • description: hypothetical protein
  • length: 55
  • theoretical pI: 9.81263
  • theoretical MW: 6488.7
  • GRAVY: 0.474545

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    exosortase F-associated protein (TIGR04127; HMM-score: 15.6)
  • TheSEED:  
    FIG01108114: hypothetical protein 
  • PFAM:
    no clan definedDUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 17.1)
    DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 15.1)
    PqiA; Paraquat-inducible protein A (PF04403; HMM-score: 14)
    Rab5ip; Rab5-interacting protein (Rab5ip) (PF07019; HMM-score: 13.5)
    LysE (CL0292) TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.208
    • Ymax_pos: 25
    • Cmax: 0.236
    • Cmax_pos: 27
    • Smax: 0.322
    • Smax_pos: 13
    • Smean: 0.236
    • D: 0.219
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRYVISIIMGIVLAIWSFKQLSQSHLDSGFIFFFIVYVLCISCFNSDKHDKNKKR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]