From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2517 [new locus tag: NWMN_RS14455 ]
  • pan locus tag?: SAUPAN006325000
  • symbol: cysG
  • pan gene symbol?:
  • synonym:
  • product: precorrin-2 dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2517 [new locus tag: NWMN_RS14455 ]
  • symbol: cysG
  • product: precorrin-2 dehydrogenase
  • replicon: chromosome
  • strand: -
  • coordinates: 2767458..2768063
  • length: 606
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAATATGCCATTAATGATAGATTTAACAAATAAAAATGTCGTCATAGTTGGTGGAGGC
    GTCGTTGCAAGTCGTCGGGCACAAACATTAAATCAATACGTTGAACATATGACGGTCATC
    AGTCCGACAATCACTGAAAAACTTCAAAATATGGTAGATAACGGTGTCGTCATATGGAAA
    GAAAAAGAATTTGAACCAAGCGATATTGTAGACGCGTATCTAGTTATTGCAGCAACCAAT
    GAGCCACGTGTCAATGAAGCGGTAAAAAAAGCCTTACCTGAGCATGCCCTTTTTAATAAT
    GTTGGAGATGCATCAAATGGCAATGTTGTATTTCCAAGTGCACTACACCGCGACAAGCTA
    ACTATCAGTGTATCAACTGATGGTGCGAGTCCTAAGTTGACAAAATCAATTATGGCAGAG
    CTTGAGGCGTTATATCCACCATCATACAGTTCGTATATCGACTTTTTATATACTTGCCGA
    CAGAAAATAAAAGTACTTGATATAACATATAACGAAAAGCAACAGTTACTGTCACAAATT
    GTGTCACAAGAATATTTAAATCATGACAAACAAGCTCAATTTTTAGCGTGGTTGGATGTA
    AGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    606

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2517 [new locus tag: NWMN_RS14455 ]
  • symbol: CysG
  • description: precorrin-2 dehydrogenase
  • length: 201
  • theoretical pI: 5.66459
  • theoretical MW: 22541.7
  • GRAVY: -0.146766

Function[edit source | edit]

  • reaction:
    Precorrin-2 + NAD+ = sirohydrochlorin + NADH?
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminsiroheme synthase, N-terminal domain (TIGR01470; HMM-score: 113.1)
    MetabolismEnergy metabolismElectron transportthioredoxin-disulfide reductase (TIGR01292; EC 1.8.1.9; HMM-score: 14.4)
  • TheSEED:  
    Siroheme synthase / Precorrin-2 oxidase (EC 1.3.1.76) 
  • PFAM:
    NADP_Rossmann (CL0063) NAD_binding_7; Putative NAD(P)-binding (PF13241; HMM-score: 81.4)
    no clan definedSirohm_synth_M; Sirohaem biosynthesis protein central (PF14824; HMM-score: 26.6)
    NADP_Rossmann (CL0063) 2-Hacid_dh_C; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826; HMM-score: 19.9)
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 17.6)
    Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 16)
    Shikimate_DH; Shikimate / quinate 5-dehydrogenase (PF01488; HMM-score: 13.1)
    Actin_ATPase (CL0108) BcrAD_BadFG; BadF/BadG/BcrA/BcrD ATPase family (PF01869; HMM-score: 11.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.206
    • Ymax_pos: 24
    • Cmax: 0.13
    • Cmax_pos: 24
    • Smax: 0.426
    • Smax_pos: 13
    • Smean: 0.316
    • D: 0.249
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNMPLMIDLTNKNVVIVGGGVVASRRAQTLNQYVEHMTVISPTITEKLQNMVDNGVVIWKEKEFEPSDIVDAYLVIAATNEPRVNEAVKKALPEHALFNNVGDASNGNVVFPSALHRDKLTISVSTDGASPKLTKSIMAELEALYPPSYSSYIDFLYTCRQKIKVLDITYNEKQQLLSQIVSQEYLNHDKQAQFLAWLDVR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: NWMN_1528 (CymR*)
    CymR* (TF) important in Cysteine metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]