From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS00150 [old locus tag: NWMN_0025 ]
  • pan locus tag?: SAUPAN000051000
  • symbol: NWMN_RS00150
  • pan gene symbol?:
  • synonym:
  • product: dihydrouridine synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS00150 [old locus tag: NWMN_0025 ]
  • symbol: NWMN_RS00150
  • product: dihydrouridine synthase
  • replicon: chromosome
  • strand: -
  • coordinates: 36552..37004
  • length: 453
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (36552..37004) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTAAAGTAGATGCACATTGGGAATTAATCGAAGCTATTAAAAATTTACGTGACGAA
    ATTGCACCAAACACATTGTTAACAATTAACGATGATATTCCCGATAGAAAAACAGGACTT
    GAACTTGCAGAAAAATATGGTATTGATGGCATCATGATTGGTAGAGGCATTTTCCACAAT
    CCATTCACTTTTGAAAAAGAACCACGCGAACACACAAGCAAAGAACTATTAGATTTGTTG
    AGATTGCATCTATCATTGTTTAACAAATATGAGAAAGATGAAATACGACAATTCAAGAGT
    TTGCGTAGATTCTTTAAAATCTATGTGCGTGGCATAAGAGGCGCTAGCGAACTTCGCCAT
    CAATTGATGAACACACAATCAATTGCAGAAGTACGAGCACTACTAGATGAATTTGAAGCC
    CAAATGGACGAAGACGTTAAAATTGAATTATAG
    60
    120
    180
    240
    300
    360
    420
    453

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS00150 [old locus tag: NWMN_0025 ]
  • symbol: NWMN_RS00150
  • description: dihydrouridine synthase
  • length: 150
  • theoretical pI: 5.66706
  • theoretical MW: 17640.1
  • GRAVY: -0.483333

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralputative TIM-barrel protein, nifR3 family (TIGR00737; HMM-score: 46.9)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA dihydrouridine synthase A (TIGR00742; EC 1.-.-.-; HMM-score: 16.6)
  • TheSEED:
  • PFAM:
    TIM_barrel (CL0036) Dus; Dihydrouridine synthase (Dus) (PF01207; HMM-score: 45.9)
    no clan definedMPS2; Monopolar spindle protein 2 (PF17060; HMM-score: 14.9)
    GT-B (CL0113) Glycos_transf_1; Glycosyl transferases group 1 (PF00534; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.097
    • Ymax_pos: 43
    • Cmax: 0.109
    • Cmax_pos: 43
    • Smax: 0.114
    • Smax_pos: 70
    • Smean: 0.067
    • D: 0.085
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000048258 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSKVDAHWELIEAIKNLRDEIAPNTLLTINDDIPDRKTGLELAEKYGIDGIMIGRGIFHNPFTFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQLMNTQSIAEVRALLDEFEAQMDEDVKIEL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS00150 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]