From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10345 [old locus tag: NWMN_1804 ]
  • pan locus tag?: SAUPAN001749000
  • symbol: NWMN_RS10345
  • pan gene symbol?:
  • synonym:
  • product: DNA replication protein DnaC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10345 [old locus tag: NWMN_1804 ]
  • symbol: NWMN_RS10345
  • product: DNA replication protein DnaC
  • replicon: chromosome
  • strand: -
  • coordinates: 2011948..2012727
  • length: 780
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2011948..2012727) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAACCACTATTCAGCGAAAAGATAAACGAAAGCTTGAAAAAATATCAACCTACTCAT
    GTCGAAAAAGGATTGAAATGTGAGAGATGTGGAAGTGAATACGACTTATATAAGTTTGCT
    CCTACTAAAAAACACCCGAATGGTTACGAGTATAAAGACGGTTGCAAATGTGAAATCTAT
    GAGGAATATAAGCGAAACAAGCAACGGAAGATAAACAACATATTCAATCAATCAAACGTT
    AATCCGTCTTTAAGAGATGCAACAGTCAAAAACTACAAGCCACAAAATGAAAAACAAGTA
    CACGCTAAACAAACAGCAATAGAGTACGTACAAGGCTTCTCTACAAAAGAACCAAAATCA
    TTAATATTGCAAGGTTCATACGGAACTGGTAAAAGCCACCTAGCATACGCTATCGCAAAA
    GCAGTCAAAGCTAAAGGGCATACGGTTGCTTTTATGCACATACCAATGTTGATGGATCGT
    ATCAAAGCGACATACAACAAAAATGCAGTAGAGACTACAGACGAGCTAGTCAGATTGCTA
    AGTGATATTGATTTACTTGTACTAGATGATATGGGTGTAGAAAACACAGAGCACACTTTA
    AATAAACTTTTCAGCATTGTTGATAACAGAGTAGGTAAAAACAACATCTTTACAACTAAC
    TTTAGTGATAAAGAACTAAATCAAAATATGAACTGGCAACGTATCAATTCAAGAATGAAA
    CACAATGCGAGAAAAGTAAGAGTAATCGGAGACGATTTCAGGGAGCGAGATGCATGGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10345 [old locus tag: NWMN_1804 ]
  • symbol: NWMN_RS10345
  • description: DNA replication protein DnaC
  • length: 259
  • theoretical pI: 9.83133
  • theoretical MW: 30058.1
  • GRAVY: -0.847876

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairchromosomal replication initiator protein DnaA (TIGR00362; HMM-score: 41.5)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaA regulatory inactivator Hda (TIGR03420; HMM-score: 30.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairorc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 14)
    Genetic information processingProtein synthesistRNA and rRNA base modificationsulfur relay protein TusD/DsrE (TIGR03012; HMM-score: 13.8)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase III, delta' subunit (TIGR00678; EC 2.7.7.7; HMM-score: 13.5)
    Cellular processesCellular processesCell divisionATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 13)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 13)
    26S proteasome subunit P45 family (TIGR01242; HMM-score: 12)
  • TheSEED:
  • PFAM:
    P-loop_NTPase (CL0023) IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 68.9)
    Bac_DnaA; Bacterial dnaA protein (PF00308; HMM-score: 28.9)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 24.8)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 24.7)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 21.3)
    DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 20)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 19.2)
    AFG1_ATPase; AFG1-like ATPase (PF03969; HMM-score: 18.3)
    AAA_30; AAA domain (PF13604; HMM-score: 18.1)
    ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 17.8)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 16.9)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.6)
    DUF2791; P-loop Domain of unknown function (DUF2791) (PF10923; HMM-score: 16.3)
    PIF1; PIF1-like helicase (PF05970; HMM-score: 16.1)
    Torsin; Torsin (PF06309; HMM-score: 14.1)
    Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 13.1)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.1)
    NACHT; NACHT domain (PF05729; HMM-score: 12.9)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 12.7)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 12.6)
    ABC_tran; ABC transporter (PF00005; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.136
    • Ymax_pos: 22
    • Cmax: 0.105
    • Cmax_pos: 25
    • Smax: 0.231
    • Smax_pos: 4
    • Smean: 0.181
    • D: 0.154
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446725749 NCBI
  • RefSeq: WP_000803062 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKPLFSEKINESLKKYQPTHVEKGLKCERCGSEYDLYKFAPTKKHPNGYEYKDGCKCEIYEEYKRNKQRKINNIFNQSNVNPSLRDATVKNYKPQNEKQVHAKQTAIEYVQGFSTKEPKSLILQGSYGTGKSHLAYAIAKAVKAKGHTVAFMHIPMLMDRIKATYNKNAVETTDELVRLLSDIDLLVLDDMGVENTEHTLNKLFSIVDNRVGKNNIFTTNFSDKELNQNMNWQRINSRMKHNARKVRVIGDDFRERDAW

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10345 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]