From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10370 [old locus tag: NWMN_1809 ]
  • pan locus tag?: SAUPAN001729000
  • symbol: NWMN_RS10370
  • pan gene symbol?:
  • synonym:
  • product: chromosome replication initiation protein DnaA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10370 [old locus tag: NWMN_1809 ]
  • symbol: NWMN_RS10370
  • product: chromosome replication initiation protein DnaA
  • replicon: chromosome
  • strand: -
  • coordinates: 2015799..2016587
  • length: 789
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2015799..2016587) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACTGAGGAAAAACAAGAACCACAAGAAAAAGTAAGCATACTCAAAAAACTAAAGATA
    AATAATATCGCTGAGAAAAATAAAAGGAAATTCTATAAATTTGCAGTATACGGAAAAATT
    GGCTCAGGAAAAACCACGTTTGCTACAAGAGATAAAGACGCTTTCGTCATTGACATTAAC
    GAAGGTGGAACAACGGTTACTGACGAAGGATCAGACGTAGAAATCGAGAACTATCAACAC
    TTTGTTTATGTTGTAAATTTTTTACCTCAAATTTTACAGGAGATGAGAGAAAACGGACAA
    GAAATCAATGTTGTAGTTATTGAAACTATTCAAAAACTTAGAGATATGACATTGAATGAT
    GTGATGAAAAATAAGTCTAAAAAACCAACGTTTAATGATTGGGGAGAAGTTGCTGAACGA
    ATTGTCAGTATGTACAGATTAATAGGAAAACTTCAAGAAGAATACAAATTCCACTTTGTT
    ATTACAGGTCATGAAGGTATCAACAAAGATAAAGATGATGAAGGTAGCACTATCAACCCT
    ACTATCACTATTGAAGCGCAAGAACAAATTAAAAAAGCTATTACTTCTCAAAGTGATGTG
    TTAGCTAGGGCAATGATTGAAGAATTTGATGATAACGGAGAAAAGAAAGCTAGATATATT
    CTAAACGCTGAACCTTCTAATACGTTTGAAACAAAGATTAGACATTCACCTTCAATAACA
    ATTAACAATAAGAAATTTGCAAATCCTAGCATTACGGACGTAGTAGAAGCAATTAGAAAT
    GGAAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    789

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10370 [old locus tag: NWMN_1809 ]
  • symbol: NWMN_RS10370
  • description: chromosome replication initiation protein DnaA
  • length: 262
  • theoretical pI: 5.81837
  • theoretical MW: 29956.7
  • GRAVY: -0.657252

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage nucleotide-binding protein (TIGR01618; HMM-score: 26.5)
  • TheSEED:
  • PFAM:
    P-loop_NTPase (CL0023) AAA_24; AAA domain (PF13479; HMM-score: 111.6)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 19.6)
    AAA_22; AAA domain (PF13401; HMM-score: 14.6)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.5)
    no clan definedGasdermin; Gasdermin family (PF04598; HMM-score: 11.8)
    P-loop_NTPase (CL0023) AAA_17; AAA domain (PF13207; HMM-score: 8.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.151
    • Ymax_pos: 11
    • Cmax: 0.109
    • Cmax_pos: 54
    • Smax: 0.338
    • Smax_pos: 5
    • Smean: 0.237
    • D: 0.184
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446056242 NCBI
  • RefSeq: WP_000134097 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTEEKQEPQEKVSILKKLKINNIAEKNKRKFYKFAVYGKIGSGKTTFATRDKDAFVIDINEGGTTVTDEGSDVEIENYQHFVYVVNFLPQILQEMRENGQEINVVVIETIQKLRDMTLNDVMKNKSKKPTFNDWGEVAERIVSMYRLIGKLQEEYKFHFVITGHEGINKDKDDEGSTINPTITIEAQEQIKKAITSQSDVLARAMIEEFDDNGEKKARYILNAEPSNTFETKIRHSPSITINNKKFANPSITDVVEAIRNGN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10370 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]