From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10915 [old locus tag: NWMN_1897 ]
  • pan locus tag?: SAUPAN001370000
  • symbol: NWMN_RS10915
  • pan gene symbol?:
  • synonym:
  • product: peptidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS10915 [old locus tag: NWMN_1897 ]
  • symbol: NWMN_RS10915
  • product: peptidase
  • replicon: chromosome
  • strand: -
  • coordinates: 2110562..2111299
  • length: 738
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2110562..2111299) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAAGCGGAGATTAAAGGCGTCATCGTTTCCAACGAAGATAAATGGGTTTACGAAATG
    CTTGGTATGGATTCGACTTGTCCTAAAGATGTTTTAACACAACTAGAATTTAGTGATGAA
    GATGTTGATATTATAATTAACTCAAATGGTGGTAACCTAGTAGCTGGTAGTGAAATATAT
    ACACATTTAAGAGCTCATAAAGGCAAAGTGAATGTTCGTATCACAGCAATAGCAGCAAGT
    GCGGCATCGCTTATCGCAATGGCTGGTGACCACATCGAAATGAGTCCGGTTGCTAGAATG
    ATGATTCACAATCCTTCAAGTATTGCGCAAGGAGAAGCGAAAGATCTAAATCATGCTGCA
    GAAACATTAGAACATGTTGGTCAAATAATGGCTGAGGCATATGCGGTTAGAGCTGGTAAA
    AACAAACAAGAACTTGTAGAAATGATGGCTAGGGAAACGTGGCTAAATGCTGATGAAGCC
    ATTGAACAAGGTTTTGCGGATAGTAAAATGTTTGAAAACGACAATATGCAAATTGTAGCA
    AGCAATACACAAGTGTTATCGAAAGATGTATTAAATCGTGTAACAGCTTTGGTAAGTAAA
    ACGCCAGAGGTTAACATTGATATTGACGCAATAGCAAATAAAGTAATTGAAAAAATAAAT
    ATGAAAGAAAAGGAATCAGAAATCGATGTTGCAGATAGTAAAGTATCAGCAAATGGATTT
    TCAAGATTCCTTTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    738

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS10915 [old locus tag: NWMN_1897 ]
  • symbol: NWMN_RS10915
  • description: peptidase
  • length: 245
  • theoretical pI: 4.59748
  • theoretical MW: 26839.4
  • GRAVY: -0.161224

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesATP-dependent Clp endopeptidase, proteolytic subunit ClpP (TIGR00493; EC 3.4.21.92; HMM-score: 63.1)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidessignal peptide peptidase SppA, 36K type (TIGR00706; EC 3.4.-.-; HMM-score: 25.8)
  • TheSEED:
  • PFAM:
    ClpP_crotonase (CL0127) CLP_protease; Clp protease (PF00574; HMM-score: 110)
    SDH_sah; Serine dehydrogenase proteinase (PF01972; HMM-score: 33.6)
    Peptidase_S49; Peptidase family S49 (PF01343; HMM-score: 15.1)
    no clan definedS-AdoMet_synt_N; S-adenosylmethionine synthetase, N-terminal domain (PF00438; HMM-score: 14.1)
    DUF3570; Protein of unknown function (DUF3570) (PF12094; HMM-score: 12.4)
    PLN_propep; Protealysin propeptide (PF16485; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.114
    • Ymax_pos: 45
    • Cmax: 0.108
    • Cmax_pos: 57
    • Smax: 0.173
    • Smax_pos: 33
    • Smean: 0.082
    • D: 0.102
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446565382 NCBI
  • RefSeq: WP_000642728 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKAEIKGVIVSNEDKWVYEMLGMDSTCPKDVLTQLEFSDEDVDIIINSNGGNLVAGSEIYTHLRAHKGKVNVRITAIAASAASLIAMAGDHIEMSPVARMMIHNPSSIAQGEAKDLNHAAETLEHVGQIMAEAYAVRAGKNKQELVEMMARETWLNADEAIEQGFADSKMFENDNMQIVASNTQVLSKDVLNRVTALVSKTPEVNIDIDAIANKVIEKINMKEKESEIDVADSKVSANGFSRFLF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS10915 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]