From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11105 [old locus tag: NWMN_1924 ]
  • pan locus tag?: SAUPAN005161000
  • symbol: NWMN_RS11105
  • pan gene symbol?: hlb
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS11105 [old locus tag: NWMN_1924 ]
  • symbol: NWMN_RS11105
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2130661..2131125
  • length: 465
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (2130661..2131125) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAAGATTGTTAGGTTTATTATTAGTGAGCACGTTAGTGTTAAGTGCATGTGGAAAT
    GATGAGAATCAGGAAGAATCTAAAAAAGAAGTTAAATCAAAAGAAAAGAAAATTGAGAAG
    GAAAAGGAAAATAAATCGAAAAAAGATAAGGAAAAAGAAGTTGCAACACAACAACAACCA
    GACAATCAAACCGTTGAACAACCCCAATCACAAGAGCAATCGGTTCAACAACCGCAACAA
    CAGATACCACAAAATAGTGTTCCTCAGCAAAATGTCCAAGTTCAACAAAACAAAAAGCAA
    AAAGTTGATTTAAATAATATGCCTCCCACTGATTTTTCTACAGAGGGTATGTCTGAGCAG
    GCTCAAAAACAAATTGAAGAGCTTTCAATGCAAAAAGACTATCATGGTCTGTCACAAAGA
    GAATACAATGATAGAGTTTCTGAAATTATAAATAATGATAATTGA
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS11105 [old locus tag: NWMN_1924 ]
  • symbol: NWMN_RS11105
  • description: hypothetical protein
  • length: 154
  • theoretical pI: 4.93322
  • theoretical MW: 17766.5
  • GRAVY: -1.44545

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 15.1)
    Cellular processesCellular processesCell divisioncell division protein ZipA (TIGR02205; HMM-score: 9.4)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 8.8)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 8.1)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscation transporter family protein (TIGR00860; HMM-score: 7.1)
    Cellular processesCellular processesPathogenesisputative immunoglobulin-blocking virulence protein (TIGR04526; HMM-score: 6.5)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 4.7)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsferrous iron transport protein B (TIGR00437; HMM-score: 3.4)
    Genetic information processingTranscriptionDegradation of RNAribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 3)
    MetabolismTransport and binding proteinsOtherK-Cl cotransporter (TIGR00930; HMM-score: 2.5)
  • TheSEED:
  • PFAM:
    no clan definedTrypan_PARP; Procyclic acidic repetitive protein (PARP) (PF05887; HMM-score: 17.1)
    ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 15.6)
    DUF4887; Domain of unknown function (DUF4887) (PF16228; HMM-score: 14.4)
    LYRIC; Lysine-rich CEACAM1 co-isolated protein family (PF15686; HMM-score: 12.4)
    Lipase_bact_N; Bacterial virulence factor lipase N-terminal (PF12262; HMM-score: 12.3)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.9)
    no clan definedPinin_SDK_memA; pinin/SDK/memA/ protein conserved region (PF04696; HMM-score: 11.6)
    TP53IP5; Cellular tumour antigen p53-inducible 5 (PF15331; HMM-score: 11.4)
    DUF4969; Domain of unknown function (DUF4969) (PF16339; HMM-score: 11.2)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 8.6)
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 8.4)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 7.1)
    P-loop_NTPase (CL0023) LAP1C; Lamina-associated polypeptide 1C (LAP1C) (PF05609; HMM-score: 6.6)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 6.4)
    no clan definedLin-8; Ras-mediated vulval-induction antagonist (PF03353; HMM-score: 6.2)
    Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region (PF02932; HMM-score: 6.2)
    SLC12; Solute carrier family 12 (PF03522; HMM-score: 5.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.409
    • Ymax_pos: 25
    • Cmax: 0.211
    • Cmax_pos: 25
    • Smax: 0.92
    • Smax_pos: 17
    • Smean: 0.823
    • D: 0.571
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446748691 NCBI
  • RefSeq: WP_000825947 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKRLLGLLLVSTLVLSACGNDENQEESKKEVKSKEKKIEKEKENKSKKDKEKEVATQQQPDNQTVEQPQSQEQSVQQPQQQIPQNSVPQQNVQVQQNKKQKVDLNNMPPTDFSTEGMSEQAQKQIEELSMQKDYHGLSQREYNDRVSEIINNDN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS11105 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]