From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS15145
  • pan locus tag?:
  • symbol: NWMN_RS15145
  • pan gene symbol?:
  • synonym:
  • product: 50S ribosomal protein L33

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS15145
  • symbol: NWMN_RS15145
  • product: 50S ribosomal protein L33
  • replicon: chromosome
  • strand: +
  • coordinates: 571451..571594
  • length: 144
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (571451..571594) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    GTGAGAAAAATACCTTTAAATTGTGAAGCTTGTGGCAATAGAAATTATAATGTTCCTAAG
    CAAGAAGGCTCGGCAACAAGATTAACCTTAAAGAAATATTGTCCAAAATGTAACGCGCAC
    ACAATTCATAAAGAATCGAAATAA
    60
    120
    144

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS15145
  • symbol: NWMN_RS15145
  • description: 50S ribosomal protein L33
  • length: 47
  • theoretical pI: 10.0872
  • theoretical MW: 5375.25
  • GRAVY: -1.03617

Function[edit source | edit]

  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL33 (TIGR01023; HMM-score: 51.7)
  • TheSEED:
  • PFAM:
    Zn_Beta_Ribbon (CL0167) Ribosomal_L33; Ribosomal protein L33 (PF00471; HMM-score: 60)
    and 14 more
    NOB1_Zn_bind; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 17.6)
    DZR; Double zinc ribbon (PF12773; HMM-score: 16.1)
    Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 15.6)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 15.2)
    no clan definedNop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 14.5)
    Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 14.4)
    zf-C4_Topoisom; Topoisomerase DNA binding C4 zinc finger (PF01396; HMM-score: 14.3)
    Nudix_N_2; Nudix N-terminal (PF14803; HMM-score: 14.2)
    no clan definedHypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 13.6)
    DUF983; Protein of unknown function (DUF983) (PF06170; HMM-score: 12.3)
    Zn_Beta_Ribbon (CL0167) zf-RRN7; Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7 (PF11781; HMM-score: 12.1)
    no clan definedVP_N-CPKC; Virion protein N terminal domain (PF11475; HMM-score: 12)
    ADK_lid; Adenylate kinase, active site lid (PF05191; HMM-score: 11.5)
    Zn_Beta_Ribbon (CL0167) zf-NADH-PPase; NADH pyrophosphatase zinc ribbon domain (PF09297; HMM-score: 10.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 12
    • Cmax: 0.11
    • Cmax_pos: 42
    • Smax: 0.3
    • Smax_pos: 1
    • Smean: 0.219
    • D: 0.178
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001788193 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKESK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS15145 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]