From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0032 [new locus tag: SA_RS00305 ]
  • pan locus tag?: SAUPAN000091000
  • symbol: bleO
  • pan gene symbol?: ble
  • synonym:
  • product: bleomycin resistance protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0032 [new locus tag: SA_RS00305 ]
  • symbol: bleO
  • product: bleomycin resistance protein
  • replicon: chromosome
  • strand: -
  • coordinates: 40197..40601
  • length: 405
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    GTGAGAATGTTACAGTCTATCCCGGCATTGCCAGTCGGGGATATTAAAAAGAGTATAGGT
    TTTTATTGCGATAAACTAGGTTTCACTTTGGTTCACCATGAAGATGGATTCGCAGTTCTA
    ATGTGTAATGAGGTTCGGATTCATCTATGGGAGGCAAGTGATGAAGGCTGGCGCTCTCGT
    AGTAATGATTCACCGGTTTGTACAGGTGCGGAGTCGTTTATTGCTGGTACTGCTAGTTGC
    CGCATTGAAGTAGAGGGAATTGATGAATTATATCAACATATTAAGCCTTTGGGCATTTTG
    CACCCCAATACATCATTAAAAGATCAGTGGTGGGATGAACGAGACTTTGCAGTAATTGAT
    CCCGACAACAATTTGATTAGCTTTTTTCAACAAATAAAAAGCTAA
    60
    120
    180
    240
    300
    360
    405

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0032 [new locus tag: SA_RS00305 ]
  • symbol: BleO
  • description: bleomycin resistance protein
  • length: 134
  • theoretical pI: 4.74765
  • theoretical MW: 15209.2
  • GRAVY: -0.218657

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismOtherlactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 16.9)
    MetabolismCentral intermediary metabolismAmino sugarslactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 16.9)
    3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 11.5)
  • TheSEED:  
    Bleomycin resistance protein 
  • PFAM:
    Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 38.1)
    Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 19.4)
    CppA_N; CppA N-terminal (PF14506; HMM-score: 15.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.138
    • Ymax_pos: 18
    • Cmax: 0.111
    • Cmax_pos: 39
    • Smax: 0.25
    • Smax_pos: 5
    • Smean: 0.187
    • D: 0.157
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRMLQSIPALPVGDIKKSIGFYCDKLGFTLVHHEDGFAVLMCNEVRIHLWEASDEGWRSRSNDSPVCTGAESFIAGTASCRIEVEGIDELYQHIKPLGILHPNTSLKDQWWDERDFAVIDPDNNLISFFQQIKS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

T Ito, Y Katayama, K Hiramatsu
Cloning and nucleotide sequence determination of the entire mec DNA of pre-methicillin-resistant Staphylococcus aureus N315.
Antimicrob. Agents Chemother.: 1999, 43(6);1449-58
[PubMed:10348769] [WorldCat.org] (P p)