From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0040 [new locus tag: SA_RS00345 ]
  • pan locus tag?: SAUPAN000104000
  • symbol: mecI
  • pan gene symbol?: mecI
  • synonym:
  • product: methicillin resistance regulatory protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0040 [new locus tag: SA_RS00345 ]
  • symbol: mecI
  • product: methicillin resistance regulatory protein
  • replicon: chromosome
  • strand: +
  • coordinates: 48894..49265
  • length: 372
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGG
    ATGAAAAAATATGCAAGTGCGAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGG
    AGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGT
    AAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATAT
    AAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTA
    AACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTG
    AATAAAAAATAA
    60
    120
    180
    240
    300
    360
    372

Protein[edit source | edit]

Protein Data Bank: 1OKR
Protein Data Bank: 1SAX
Protein Data Bank: 1SD6
Protein Data Bank: 1SD7
Protein Data Bank: 2D45

General[edit source | edit]

  • locus tag: SA0040 [new locus tag: SA_RS00345 ]
  • symbol: MecI
  • description: methicillin resistance regulatory protein
  • length: 123
  • theoretical pI: 9.46589
  • theoretical MW: 14789.9
  • GRAVY: -0.74065

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)
    Signal transductionRegulatory functionsDNA interactionscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 16.5)
    Signal transductionRegulatory functionsDNA interactionsphenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 16)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.8)
  • TheSEED:  
    Methicillin resistance repressor MecI 
  • PFAM:
    HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 130.6)
    MarR; MarR family (PF01047; HMM-score: 23.4)
    PaaX; PaaX-like protein (PF07848; HMM-score: 17.9)
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 17.2)
    no clan definedDUF3489; Protein of unknown function (DUF3489) (PF11994; HMM-score: 15.2)
    SRP54_N; SRP54-type protein, helical bundle domain (PF02881; HMM-score: 14.7)
    HTH (CL0123) Cullin_Nedd8; Cullin protein neddylation domain (PF10557; HMM-score: 14.3)
    Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)
    no clan definedDUF1160; Protein of unknown function (DUF1160) (PF06648; HMM-score: 13.2)
    post-AAA (CL0604) Rep_fac_C; Replication factor C C-terminal domain (PF08542; HMM-score: 12.7)
    HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 11.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.135
    • Ymax_pos: 28
    • Cmax: 0.198
    • Cmax_pos: 28
    • Smax: 0.16
    • Smax_pos: 21
    • Smean: 0.074
    • D: 0.111
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: MecI
    MecI (TF) important in Penicillin and methicillin resistanceRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

T Ito, Y Katayama, K Hiramatsu
Cloning and nucleotide sequence determination of the entire mec DNA of pre-methicillin-resistant Staphylococcus aureus N315.
Antimicrob. Agents Chemother.: 1999, 43(6);1449-58
[PubMed:10348769] [WorldCat.org] (P p)
Raquel García-Castellanos, Aniebrys Marrero, Goretti Mallorquí-Fernández, Jan Potempa, Miquel Coll, F Xavier Gomis-Ruth
Three-dimensional structure of MecI. Molecular basis for transcriptional regulation of staphylococcal methicillin resistance.
J. Biol. Chem.: 2003, 278(41);39897-905
[PubMed:12881514] [WorldCat.org] [DOI] (P p)
Raquel García-Castellanos, Goretti Mallorquí-Fernández, Aniebrys Marrero, Jan Potempa, Miquel Coll, F Xavier Gomis-Rüth
On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator.
J. Biol. Chem.: 2004, 279(17);17888-96
[PubMed:14960592] [WorldCat.org] [DOI] (P p)
K Hiramatsu, K Asada, E Suzuki, K Okonogi, T Yokota
Molecular cloning and nucleotide sequence determination of the regulator region of mecA gene in methicillin-resistant Staphylococcus aureus (MRSA).
FEBS Lett.: 1992, 298(2-3);133-6
[PubMed:1544435] [WorldCat.org] (P p)
Martin K Safo, Qixun Zhao, Tzu-Ping Ko, Faik N Musayev, Howard Robinson, Neel Scarsdale, Andrew H-J Wang, Gordon L Archer
Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons.
J. Bacteriol.: 2005, 187(5);1833-44
[PubMed:15716455] [WorldCat.org] [DOI] (P p)
Martin K Safo, Tzu Ping Ko, Faik N Musayev, Qixun Zhao, Andrew H J Wang, Gordon L Archer
Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun.: 2006, 62(Pt 4);320-4
[PubMed:16582476] [WorldCat.org] [DOI] (I p)