From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0040 [new locus tag: SA_RS00345 ]
  • pan locus tag?: SAUPAN000104000
  • symbol: mecI
  • pan gene symbol?: mecI
  • synonym:
  • product: methicillin resistance regulatory protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA0040 [new locus tag: SA_RS00345 ]
  • symbol: mecI
  • product: methicillin resistance regulatory protein
  • replicon: chromosome
  • strand: +
  • coordinates: 48894..49265
  • length: 372
  • essential: no DEG

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGG
    ATGAAAAAATATGCAAGTGCGAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGG
    AGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATAAAAAGGGATTTATAGATCGT
    AAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATAT
    AAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTA
    AACTTTGTAGAAAAAGAAGATCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTG
    AATAAAAAATAA
    60
    120
    180
    240
    300
    360
    372

⊟Protein[edit | edit source]

Protein Data Bank: 1OKR
Protein Data Bank: 1SAX
Protein Data Bank: 1SD6
Protein Data Bank: 1SD7
Protein Data Bank: 2D45

⊟General[edit | edit source]

  • locus tag: SA0040 [new locus tag: SA_RS00345 ]
  • symbol: MecI
  • description: methicillin resistance regulatory protein
  • length: 123
  • theoretical pI: 9.46589
  • theoretical MW: 14789.9
  • GRAVY: -0.74065

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 102.1)
    and 3 more
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 16.5)
    Signal transduction Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 16)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.8)
  • TheSEED  :
    • Methicillin resistance repressor MecI
    MRSA analysis Oli  Methicillin resistance repressor MecI
  • PFAM:
    HTH (CL0123) Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 130.6)
    and 10 more
    MarR; MarR family (PF01047; HMM-score: 23.4)
    PaaX; PaaX-like protein (PF07848; HMM-score: 17.9)
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 17.2)
    no clan defined DUF3489; Protein of unknown function (DUF3489) (PF11994; HMM-score: 15.2)
    SRP54_N; SRP54-type protein, helical bundle domain (PF02881; HMM-score: 14.7)
    HTH (CL0123) Cullin_Nedd8; Cullin protein neddylation domain (PF10557; HMM-score: 14.3)
    Sulfolobus_pRN; Sulfolobus plasmid regulatory protein (PF05584; HMM-score: 13.5)
    no clan defined DUF1160; Protein of unknown function (DUF1160) (PF06648; HMM-score: 13.2)
    post-AAA (CL0604) Rep_fac_C; Replication factor C C-terminal domain (PF08542; HMM-score: 12.7)
    HTH (CL0123) LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 11.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors: Methicillin; Penicillin G
  • genes regulated by MecI, TF important in Penicillin and methicillin resistanceRegPrecise
    repression
    mecA
    mecR1 > mecI

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009467
    • TAT(Tat/SPI): 0.000301
    • LIPO(Sec/SPII): 0.001842
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: MecI (repression) regulon
    MecI(TF)important in Penicillin and methicillin resistance; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

T Ito, Y Katayama, K Hiramatsu
Cloning and nucleotide sequence determination of the entire mec DNA of pre-methicillin-resistant Staphylococcus aureus N315.
Antimicrob Agents Chemother: 1999, 43(6);1449-58
[PubMed:10348769] [WorldCat.org] [DOI] (P p)Raquel García-Castellanos, Aniebrys Marrero, Goretti Mallorquí-Fernández, Jan Potempa, Miquel Coll, F Xavier Gomis-Ruth
Three-dimensional structure of MecI. Molecular basis for transcriptional regulation of staphylococcal methicillin resistance.
J Biol Chem: 2003, 278(41);39897-905
[PubMed:12881514] [WorldCat.org] [DOI] (P p)Raquel García-Castellanos, Goretti Mallorquí-Fernández, Aniebrys Marrero, Jan Potempa, Miquel Coll, F Xavier Gomis-Rüth
On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator.
J Biol Chem: 2004, 279(17);17888-96
[PubMed:14960592] [WorldCat.org] [DOI] (P p)K Hiramatsu, K Asada, E Suzuki, K Okonogi, T Yokota
Molecular cloning and nucleotide sequence determination of the regulator region of mecA gene in methicillin-resistant Staphylococcus aureus (MRSA).
FEBS Lett: 1992, 298(2-3);133-6
[PubMed:1544435] [WorldCat.org] [DOI] (P p)Martin K Safo, Qixun Zhao, Tzu-Ping Ko, Faik N Musayev, Howard Robinson, Neel Scarsdale, Andrew H-J Wang, Gordon L Archer
Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons.
J Bacteriol: 2005, 187(5);1833-44
[PubMed:15716455] [WorldCat.org] [DOI] (P p)Martin K Safo, Tzu Ping Ko, Faik N Musayev, Qixun Zhao, Andrew H J Wang, Gordon L Archer
Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec.
Acta Crystallogr Sect F Struct Biol Cryst Commun: 2006, 62(Pt 4);320-4
[PubMed:16582476] [WorldCat.org] [DOI] (I p)

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA0040&oldid=79753"