From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0063
  • pan locus tag?: SAUPAN000450000
  • symbol: tnp
  • pan gene symbol?: tnp
  • synonym:
  • product: transposase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0063
  • symbol: tnp
  • product: transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 70698..71051
  • length: 354
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    GTGGTACCAACAGTAGTCATAGATTTAGTGGATCAATTAAAAGGAAACTATTCAATCAAA
    TTGATACTAGAAGTATTAAATATACCTAAATCAACATATTACCGATGGAAAAACAAAACC
    TATAAAAATGATACTGTAACACAAAAAGTTATTGAATTATGTGAAGCTAACCATTATACC
    TACGGTTATCGTAAGATTACAGCACTGATTAATCAATGTTATACATCACCAATTAATCAT
    AAGAGAGTACAGAGAATGATGCAGAAGCATCATTTGAACTGCCGAGTTAGACCTAAAAAG
    ACGACAAGGATAGGTAAACCGTATTATAAAACAGACAATTTATTACAAAGATAA
    60
    120
    180
    240
    300
    354

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0063
  • symbol: Tnp
  • description: transposase
  • length: 117
  • theoretical pI: 10.4286
  • theoretical MW: 13989.3
  • GRAVY: -0.688034

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Mobile element protein 
  • PFAM:
    HTH (CL0123) HTH_21; HTH-like domain (PF13276; HMM-score: 61.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.8)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 15)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.3)
    Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 19
    • Cmax: 0.11
    • Cmax_pos: 36
    • Smax: 0.162
    • Smax_pos: 34
    • Smean: 0.11
    • D: 0.111
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 29165617 NCBI
  • RefSeq: NP_373303 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVPTVVIDLVDQLKGNYSIKLILEVLNIPKSTYYRWKNKTYKNDTVTQKVIELCEANHYTYGYRKITALINQCYTSPINHKRVQRMMQKHHLNCRVRPKKTTRIGKPYYKTDNLLQR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]