From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0887 [new locus tag: SA_RS05035 ]
  • pan locus tag?: SAUPAN003224000
  • symbol: SA0887
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0887 [new locus tag: SA_RS05035 ]
  • symbol: SA0887
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1009304..1009624
  • length: 321
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAATTTATCATTGCAATATTATTAGGATTAATCGTATCCATTACTATTGCTTTTACA
    ATCATACATCATCCTATACTTGATCGTTTTAATCCTTTCTTAAAAACGGAGTATAGTTAT
    GCCAAAGTGCCAAAAGGTACGCAACAATATGTTAATATTACGGCTTATAGTGAAAGAGGG
    GAAAAGCTTGATTATAAATTAACATTTAATGGATTTTCACCTAGTAGAACGTATGTCGAA
    ATAAAGCATAAAGGGCAATATGTCATATCGATCACATATGTTGAAAAAGAGGATATACCA
    AAAGAGGTAAGACAAGAATGA
    60
    120
    180
    240
    300
    321

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0887 [new locus tag: SA_RS05035 ]
  • symbol: SA0887
  • description: hypothetical protein
  • length: 106
  • theoretical pI: 9.5064
  • theoretical MW: 12345.3
  • GRAVY: -0.146226

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Hypothetical proteinsConservedconserved hypothetical protein (TIGR01655; HMM-score: 124.7)
  • TheSEED:  
    FIG01108238: hypothetical protein 
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 5
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.219
    • Ymax_pos: 21
    • Cmax: 0.164
    • Cmax_pos: 21
    • Smax: 0.587
    • Smax_pos: 2
    • Smean: 0.355
    • D: 0.272
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFIIAILLGLIVSITIAFTIIHHPILDRFNPFLKTEYSYAKVPKGTQQYVNITAYSERGEKLDYKLTFNGFSPSRTYVEIKHKGQYVISITYVEKEDIPKEVRQE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]