From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1640 [new locus tag: SA_RS09225 ]
  • pan locus tag?: SAUPAN004607000
  • symbol: SA1640
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1640 [new locus tag: SA_RS09225 ]
  • symbol: SA1640
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1874153..1874647
  • length: 495
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAGGAGATTACTCAGTCTATTACTAGCTAGTACAATGATTTTAGTCGCATGTGGGAAT
    GCTAACAATGAAAATAAGAAAAAGGAAGACGAAAAAAAATCAGAAGTAAAAAAAGAAGCT
    ACGAAAAATAATGATAAACCAAAGAACGAAAAGAAGAATCAAGATATAAATAAAAACAAT
    AATGAGCAAGTTCAAAATGTCAATAATAAACAACCAGTCTTAAATAATAATAGTAATCAT
    AACAATCAACAACAAAGCAATAAAAATAATTACACAGTTATAGAAAACGGGAATACAGTT
    ACAGAAATTTATAATGGACAATCACACACAACTACAAATAACCCTATTAGAGAAGAATAT
    GTAGAGGGAGAAACAGACCCGATATATAAAAGAGAGTATAAGCATTTTTATACACCTGAA
    GAAGCTCAAAGAGCACAAGAAAATAGCGACCAAATTTTAAGAGAAATGGGTCTCGAACCA
    GAAAGATATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    495

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1640 [new locus tag: SA_RS09225 ]
  • symbol: SA1640
  • description: hypothetical protein
  • length: 164
  • theoretical pI: 6.29008
  • theoretical MW: 19125.8
  • GRAVY: -1.54939

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 16.9)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 15.5)
    Sec region non-globular protein (TIGR04420; HMM-score: 9.1)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 8.1)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 7.6)
    GLPGLI family protein (TIGR01200; HMM-score: 6.2)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 4.1)
    Cellular processesCellular processesSporulation and germinationstage III sporulation protein AE (TIGR02829; HMM-score: 3.3)
  • TheSEED:  
    FIG01108503: hypothetical protein 
  • PFAM:
    no clan definedFAM176; FAM176 family (PF14851; HMM-score: 12.6)
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 11.7)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 11.7)
    no clan definedTP53IP5; Cellular tumour antigen p53-inducible 5 (PF15331; HMM-score: 10.1)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 9.6)
    no clan definedDUF4638; Domain of unknown function (DUF4638) (PF15472; HMM-score: 9.5)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 9.3)
    no clan definedSerinc; Serine incorporator (Serinc) (PF03348; HMM-score: 8.9)
    Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region (PF02932; HMM-score: 8.6)
    NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 8.4)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 8.1)
    DMT (CL0184) CSG2; Ceramide synthase regulator (PF16965; HMM-score: 8.1)
    no clan definedWDCP; WD repeat and coiled-coil-containing protein family (PF15390; HMM-score: 7.7)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 7.6)
    no clan definedSpore_YhcN_YlaJ; Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) (PF09580; HMM-score: 6.5)
    CLN3; CLN3 protein (PF02487; HMM-score: 6.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ILVACGN
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.421
    • Ymax_pos: 27
    • Cmax: 0.214
    • Cmax_pos: 27
    • Smax: 0.965
    • Smax_pos: 6
    • Smean: 0.88
    • D: 0.6
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRRLLSLLLASTMILVACGNANNENKKKEDEKKSEVKKEATKNNDKPKNEKKNQDINKNNNEQVQNVNNKQPVLNNNSNHNNQQQSNKNNYTVIENGNTVTEIYNGQSHTTTNNPIREEYVEGETDPIYKREYKHFYTPEEAQRAQENSDQILREMGLEPERYE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]