From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1949 [new locus tag: SA_RS11190 ]
  • pan locus tag?: SAUPAN005448000
  • symbol: truncated-SA
  • pan gene symbol?: truncated-SA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1949 [new locus tag: SA_RS11190 ]
  • symbol: truncated-SA
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2198308..2198781
  • length: 474
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGTTTACTTACTTTAAATCAGCATTTAAAAATGCTAAACCACAATTATTAATAACATTG
    ATATATGCACTTATAGCATTTGCTGTAATTGCAGTTGTATATTTACTTGCTAATTTCCAG
    CTTGCTAAGTATGCACAAACTATTGCAATTTATTCACAATTTGGGCAAAAACCACCAGTA
    GATGCATATTTAAAAGTTATCGCTGTATTACTTATAGCAGCTGTAGTTTCACTGTTTGTT
    TTAGTTCAAATTTTTATCGGAATTACAAATGTTATGAAACGAGCAATGAGTCATGAAAAA
    GTAAAATTTACCGATTTATTTATTGCATTTAAAAAAGGTAATTATTTAAAGAGCGTTCTG
    ATCGGTCTTGTATCTATAGCAATGATTATCGTTCTTTCACTTCTGACATCATTACTATAC
    AAATTATTTTCTCCAGTATCAGAAATGATTATGAATACATCTTATCAAGAGTAA
    60
    120
    180
    240
    300
    360
    420
    474

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1949 [new locus tag: SA_RS11190 ]
  • symbol: Truncated-SA
  • description: hypothetical protein
  • length: 157
  • theoretical pI: 10.2391
  • theoretical MW: 17574.2
  • GRAVY: 0.965605

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesoligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 9.5)
    TIGR03943 family protein (TIGR03943; HMM-score: 8.1)
  • TheSEED:  
    Lytic regulatory protein 
  • PFAM:
    no clan definedSulf_transp; Sulphur transport (PF04143; HMM-score: 15.2)
    Abhydrolase_9_N; Alpha/beta-hydrolase family N-terminus (PF15420; HMM-score: 13)
    DUF624; Protein of unknown function, DUF624 (PF04854; HMM-score: 12.9)
    Yip1 (CL0112) Yip1; Yip1 domain (PF04893; HMM-score: 12.3)
    no clan definedSigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 6.7)
    Flp_Fap; Flp/Fap pilin component (PF04964; HMM-score: 6.4)
    NPCC; Nuclear pore complex component (PF08058; HMM-score: 6.3)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 6.2)
    DUF4307; Domain of unknown function (DUF4307) (PF14155; HMM-score: 6.1)
    DUF2975; Protein of unknown function (DUF2975) (PF11188; HMM-score: 6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.178
    • Ymax_pos: 45
    • Cmax: 0.186
    • Cmax_pos: 45
    • Smax: 0.395
    • Smax_pos: 15
    • Smean: 0.199
    • D: 0.186
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 15927721 NCBI
  • RefSeq: NP_375254 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MFTYFKSAFKNAKPQLLITLIYALIAFAVIAVVYLLANFQLAKYAQTIAIYSQFGQKPPVDAYLKVIAVLLIAAVVSLFVLVQIFIGITNVMKRAMSHEKVKFTDLFIAFKKGNYLKSVLIGLVSIAMIIVLSLLTSLLYKLFSPVSEMIMNTSYQE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]