From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2386 [new locus tag: SA_RS13660 ]
  • pan locus tag?: SAUPAN006288000
  • symbol: tnpC
  • pan gene symbol?: tnpC
  • synonym:
  • product: transposition regulatory protein tnpC

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2386 [new locus tag: SA_RS13660 ]
  • symbol: tnpC
  • product: transposition regulatory protein tnpC
  • replicon: chromosome
  • strand: -
  • coordinates: 2674325..2674702
  • length: 378
  • essential: no DEG

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGATAAACAAGTTAGAAATACAACAGAAATTGTACGTTTGGCGAAGCAGAAATCAAAA
    AAGACAAGGGAAAAAGTAGACAAAGCGATTTCTAAATTTTCGATTGAAGGTAAAGTTATT
    AATTTTAATTCAATAGCAAAGGAAGCTAATGTTTCTAAATCATGGCTTTATAAGGAACAC
    GATATTAGGCAAAGAATCGAATCCCTTCGTGAGCGTCAAATAACAGCAAATGTAGTCTCA
    AAACCCAAGAAAAGTTCTCGTTCGGAGGAAATCCTTATTAAAACCTTAAAAAGAAGAGTA
    ATGGAATTAGAAAAAGAAAATAAAAAATTACAGAACCAAATTCAAAAATTATATGGAGAT
    CTGTATAATAAAGAATAA
    60
    120
    180
    240
    300
    360
    378

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2386 [new locus tag: SA_RS13660 ]
  • symbol: TnpC
  • description: transposition regulatory protein tnpC
  • length: 125
  • theoretical pI: 10.822
  • theoretical MW: 14804.1
  • GRAVY: -1.0384

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    DNA 3'-phosphatase (TIGR01664; EC 3.1.3.32; HMM-score: 11.3)
  • TheSEED:  
    Mobile element protein 
  • PFAM:
    CoA-acyltrans (CL0149) Transferase; Transferase family (PF02458; HMM-score: 18.4)
    no clan definedHALZ; Homeobox associated leucine zipper (PF02183; HMM-score: 17.9)
    bZIP (CL0018) bZIP_2; Basic region leucine zipper (PF07716; HMM-score: 15.9)
    HTH (CL0123) LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 15.8)
    Mga; Mga helix-turn-helix domain (PF05043; HMM-score: 14.7)
    no clan definedSidE; Dot/Icm substrate protein (PF12252; HMM-score: 10.7)
    SlyX; SlyX (PF04102; HMM-score: 9.8)
    TPR_MLP1_2; TPR/MLP1/MLP2-like protein (PF07926; HMM-score: 7.5)
    P-loop_NTPase (CL0023) AAA_11; AAA domain (PF13086; HMM-score: 7.4)
    no clan definedHerpes_BLRF2; Herpesvirus BLRF2 protein (PF05812; HMM-score: 7.1)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 6.6)
    no clan definedDUF4337; Domain of unknown function (DUF4337) (PF14235; HMM-score: 6.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.158
    • Ymax_pos: 16
    • Cmax: 0.121
    • Cmax_pos: 49
    • Smax: 0.313
    • Smax_pos: 12
    • Smean: 0.244
    • D: 0.192
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDKQVRNTTEIVRLAKQKSKKTREKVDKAISKFSIEGKVINFNSIAKEANVSKSWLYKEHDIRQRIESLRERQITANVVSKPKKSSRSEEILIKTLKRRVMELEKENKKLQNQIQKLYGDLYNKE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]