From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0319 [new locus tag: SACOL_RS01610 ]
  • pan locus tag?: SAUPAN001420000
  • symbol: SACOL0319
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0319 [new locus tag: SACOL_RS01610 ]
  • symbol: SACOL0319
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 356184..356897
  • length: 714
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACGCATAATATAGAAAAACGCATTAATAAATTAAAAACTTCTGGAAATCCAAAATTT
    AAAAAATTAGATTCAGATATTCACTATTTACTCAAGAGATTTGAAGGTGAAAAAAACCAT
    AAAGGTTTTTATCCAAAGTTTAAACAAGGAGAAATAGTTTTTGTAGATTTCGGTATAAAC
    GTTAATAAAGAATTTTCTAATTCACACTTTGCAATAGTGATGAATAAAAATGATTCTAAT
    ACGGAAGATATAGTAAATGTTATTCCCTTATCTTCTAAAGAAAACAAAAAGTATTTAAAG
    ATGAATTTTGATTTGAAATGGGAGTATTATTTAAGATTGTTTTTAAATTTAATTAGCGCG
    CAAAATAATTCAGCTATATTAAAAGAAGTTTTCGATAAAAAATACCAAAAAAACAACACA
    GAATTCATCACTAAAGATTATTTTAGTGAATTTATATCTGATAGTTTAGAAATTGAAAAT
    AAATTAAATAAAATTGACAGAAACATTAATAACATAGTATCAGCAATTGATAAGGTAAAA
    AAATTAAAAGGTAATAGTTACGCTTGCATAAATTCTTTCCAGCCGATTAGTAAGTTTCGC
    ATAAGAAAAGTTTTACCCCCAAAAATTAAAAATCCAGTAATAGATTCTTCGGATATTATG
    TTACTGATAAATAGAATTAATAATAATATATTGCAGATTCCTGATATAAGATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0319 [new locus tag: SACOL_RS01610 ]
  • symbol: SACOL0319
  • description: hypothetical protein
  • length: 237
  • theoretical pI: 10.2531
  • theoretical MW: 27830
  • GRAVY: -0.551055

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:  
    Phages, Prophages, Transposable elements, PlasmidsPathogenicity islandsStaphylococcal pathogenicity islands SaPI Hypothetical SAR0365 homolog in superantigen-encoding pathogenicity islands SaPI 
  • PFAM:
    CcdB_PemK (CL0624) PemK_toxin; PemK-like, MazF-like toxin of type II toxin-antitoxin system (PF02452; HMM-score: 33.6)
    and 6 more
    no clan definedF_actin_bind; F-actin binding (PF08919; HMM-score: 13.3)
    XhlA; Haemolysin XhlA (PF10779; HMM-score: 12.9)
    P-loop_NTPase (CL0023) DUF87; Domain of unknown function DUF87 (PF01935; HMM-score: 12.4)
    no clan definedDUF16; Protein of unknown function DUF16 (PF01519; HMM-score: 12.2)
    Alk_phosphatase (CL0088) Phosphodiest; Type I phosphodiesterase / nucleotide pyrophosphatase (PF01663; HMM-score: 11.9)
    EF_hand (CL0220) Dockerin_1; Dockerin type I repeat (PF00404; HMM-score: 11.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.177
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 69
    • Smax: 0.401
    • Smax_pos: 2
    • Smean: 0.306
    • D: 0.228
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTHNIEKRINKLKTSGNPKFKKLDSDIHYLLKRFEGEKNHKGFYPKFKQGEIVFVDFGINVNKEFSNSHFAIVMNKNDSNTEDIVNVIPLSSKENKKYLKMNFDLKWEYYLRLFLNLISAQNNSAILKEVFDKKYQKNNTEFITKDYFSEFISDSLEIENKLNKIDRNINNIVSAIDKVKKLKGNSYACINSFQPISKFRIRKVLPPKIKNPVIDSSDIMLLINRINNNILQIPDIR

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]