From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1706 [new locus tag: SACOL_RS08710 ]
  • pan locus tag?: SAUPAN004260000
  • symbol: SACOL1706
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL1706 [new locus tag: SACOL_RS08710 ]
  • symbol: SACOL1706
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1736340..1736624
  • length: 285
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    GTGACTCTATTTATTATTATCGGGGTTCTCGTGCCAATGGTTTATACCATGCAGTTAAAT
    ATTAAAAATGAACCTGTAACAAAGCGCAATCTTTTAATAACATTAGCTTTATCTACGTTA
    GGTATTTTAGTAACCGCGTTAGCAGGTGTAATCGTTACGAAACAAGCTTTTCCTTTATTA
    AGTGTAGCAATTGGCTCAATTTTTACTGGAATCGTTTGGGGCCTTTTACTAAGTGGTAGC
    TACGCGCTGATACGATTTTTATCTAACGCATTTGGGCGTAAGTAA
    60
    120
    180
    240
    285

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL1706 [new locus tag: SACOL_RS08710 ]
  • symbol: SACOL1706
  • description: hypothetical protein
  • length: 94
  • theoretical pI: 11.2593
  • theoretical MW: 10120.3
  • GRAVY: 1.15638

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108281: hypothetical protein 
  • PFAM:
    no clan definedDUF1705; Domain of unknown function (DUF1705) (PF08019; HMM-score: 13.2)
    DUF5467; Family of unknown function (DUF5467) (PF17555; HMM-score: 9.3)
    GT-C (CL0111) YfhO; Bacterial membrane protein YfhO (PF09586; HMM-score: 8.2)
    no clan definedDUF3481; C-terminal domain of neuropilin glycoprotein (PF11980; HMM-score: 7.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.167
    • Ymax_pos: 21
    • Cmax: 0.15
    • Cmax_pos: 49
    • Smax: 0.327
    • Smax_pos: 8
    • Smean: 0.231
    • D: 0.192
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTLFIIIGVLVPMVYTMQLNIKNEPVTKRNLLITLALSTLGILVTALAGVIVTKQAFPLLSVAIGSIFTGIVWGLLLSGSYALIRFLSNAFGRK

Experimental data[edit source | edit]

  • experimental localization: Integral membrane [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]