From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2013 [new locus tag: SACOL_RS10510 ]
  • pan locus tag?: SAUPAN005240000
  • symbol: SACOL2013
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2013 [new locus tag: SACOL_RS10510 ]
  • symbol: SACOL2013
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2073768..2074205
  • length: 438
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGTTTATTTCTCTAGCTATTTGGTCAATAAATTCGATGGGTAATAAACAATGCATTAGT
    TTGAATTTATTGCTTTCGGATGATACTTTCGCAGTAATTTCAGTAATGACAACTTTGGGA
    ACTGCTATTTTAGGAGGTGTAGCACCTTCAATATATGGTATTTTTACATCGCCTATAGAT
    AAAAAAAGTAGTTTTAGGGCTATTAGCGATTGGGAGCAAGAACAAAGAAATAATGTTAAA
    GATCTGATGATGCTATTACCATTTACATTACTTAGTATTTTAATTGTGATTTTTATTTTT
    CAGTTTGCATATTCTAAACTATTTAATACGATAGCTATTATAATATTTATTATAATACTT
    GTTGTTATGTTTTTTTTAATTTTATTAATCTGTTATAAAATTACTGTGAAGATATGCAGA
    TATTTTTCAAAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    438

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2013 [new locus tag: SACOL_RS10510 ]
  • symbol: SACOL2013
  • description: hypothetical protein
  • length: 145
  • theoretical pI: 8.84397
  • theoretical MW: 16467.8
  • GRAVY: 0.993793

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MSEP-CTERM protein (TIGR04286; HMM-score: 10.6)
  • TheSEED:
  • PFAM:
    no clan definedTRP; Transient receptor potential (TRP) ion channel (PF06011; HMM-score: 12.9)
    EIID-AGA; PTS system mannose/fructose/sorbose family IID component (PF03613; HMM-score: 12.8)
    NPCC; Nuclear pore complex component (PF08058; HMM-score: 12.6)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 11.2)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 10.8)
    no clan definedDUF3043; Protein of unknown function (DUF3043) (PF11241; HMM-score: 9.9)
    Virul_fac_BrkB; Virulence factor BrkB (PF03631; HMM-score: 9.5)
    Ac76; Orf76 (Ac76) (PF05814; HMM-score: 9.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.199
    • Ymax_pos: 19
    • Cmax: 0.149
    • Cmax_pos: 19
    • Smax: 0.329
    • Smax_pos: 14
    • Smean: 0.24
    • D: 0.215
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFISLAIWSINSMGNKQCISLNLLLSDDTFAVISVMTTLGTAILGGVAPSIYGIFTSPIDKKSSFRAISDWEQEQRNNVKDLMMLLPFTLLSILIVIFIFQFAYSKLFNTIAIIIFIIILVVMFFLILLICYKITVKICRYFSKE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: RpoF (SigB*) [1] other strains
    RpoF  (SigB*) (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]