From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2059 [new locus tag: SACOL_RS10780 ]
  • pan locus tag?: SAUPAN005340000
  • symbol: SACOL2059
  • pan gene symbol?: mazE
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2059 [new locus tag: SACOL_RS10780 ]
  • symbol: SACOL2059
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2124574..2124744
  • length: 171
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGTTATCTTTTAGTCAAAATAGAAGTCATAGCTTAGAACAATCTTTAAAAGAAGGATAT
    TCACAAATGGCTGATTTAAATCTCTCCCTAGCGAACGAAGCTTTTCCGATAGAGTGTGAA
    GCATGCGATTGCAACGAAACATATTTATCTTCTAATTCAACGAATGAATGA
    60
    120
    171

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2059 [new locus tag: SACOL_RS10780 ]
  • symbol: SACOL2059
  • description: hypothetical protein
  • length: 56
  • theoretical pI: 3.83056
  • theoretical MW: 6251.76
  • GRAVY: -0.596429

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Regulation and Cell signalingProgrammed Cell Death and Toxin-antitoxin SystemsMazEF toxin-antitoxing (programmed cell death) system Programmed cell death antitoxin YdcD 
    Programmed Cell Death and Toxin-antitoxin SystemsPhd-Doc, YdcE-YdcD toxin-antitoxin (programmed cell death) systems Programmed cell death antitoxin YdcD 
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.166
    • Ymax_pos: 12
    • Cmax: 0.144
    • Cmax_pos: 42
    • Smax: 0.324
    • Smax_pos: 1
    • Smean: 0.232
    • D: 0.192
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]