From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2408 [new locus tag: SACOL_RS12635 ]
  • pan locus tag?: SAUPAN005944000
  • symbol: SACOL2408
  • pan gene symbol?:
  • synonym:
  • product: lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2408 [new locus tag: SACOL_RS12635 ]
  • symbol: SACOL2408
  • product: lipoprotein
  • replicon: chromosome
  • strand: -
  • coordinates: 2467924..2468295
  • length: 372
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    GTGGGAGCATTGAAGCGATTTGTGGCGACGGTATTATTATTACTAGTCTTTATATCAGGA
    TGTGGTAATGATAAATATGTGAAAGAAATAGATGAAGCAGTTAAAATTCAAAATCAAAAA
    CAAGAACAACTTGCCAAAAAAGGCAACGGTGATCGTGTTGATCATTTTGAACGCAAAGAT
    GCTAATATTTATGTCTATGATAAGGATAAAATTATCATTTTAGCTTATAAACCTTTGAGT
    AATGATGATGAAGTGCATTATTATGCATATGATTTTAGTGATAAACGTGTATCATATAAG
    CAAGATTTTGATTCGAGACGATATTATCAACAACATGATGCGGATTATCATGAAGAAAAT
    ATGACGAACTAG
    60
    120
    180
    240
    300
    360
    372

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2408 [new locus tag: SACOL_RS12635 ]
  • symbol: SACOL2408
  • description: lipoprotein
  • length: 123
  • theoretical pI: 6.10833
  • theoretical MW: 14570.2
  • GRAVY: -0.856911

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108076: hypothetical protein 
  • PFAM:
    NTF2 (CL0051) DUF4467; Domain of unknown function with cystatin-like fold (DUF4467) (PF14729; HMM-score: 130.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: VFISGCG
  • SignalP: no predicted signal peptide
    • Ymax: 0.295
    • Ymax_pos: 30
    • Cmax: 0.172
    • Cmax_pos: 30
    • Smax: 0.725
    • Smax_pos: 18
    • Smean: 0.562
    • D: 0.399
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MGALKRFVATVLLLLVFISGCGNDKYVKEIDEAVKIQNQKQEQLAKKGNGDRVDHFERKDANIYVYDKDKIIILAYKPLSNDDEVHYYAYDFSDKRVSYKQDFDSRRYYQQHDADYHEENMTN

Experimental data[edit source | edit]

  • experimental localization: Lipoprotein [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]