From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01120 [old locus tag: SACOL0219 ]
  • pan locus tag?: SAUPAN001104000
  • symbol: SACOL_RS01120
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS01120 [old locus tag: SACOL0219 ]
  • symbol: SACOL_RS01120
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 260333..260506
  • length: 174
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (260333..260506) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAAACTTAATCAACGTTACGTAAAAGTATTTGCATTATATTTCGTAAGTATTGTTACT
    GCAAATATTATTGTTAAAAATAATAATTTAATTAAAACATTGATACAAACCATAGCCGGG
    TACACGGTCTTTGCAGTTGGTTTGAAGTATTTAACTAAACGTAAAAATAAATGA
    60
    120
    174

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS01120 [old locus tag: SACOL0219 ]
  • symbol: SACOL_RS01120
  • description: hypothetical protein
  • length: 57
  • theoretical pI: 11.0923
  • theoretical MW: 6564.9
  • GRAVY: 0.319298

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedDUF5325; Family of unknown function (DUF5325) (PF17259; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.222
    • Ymax_pos: 14
    • Cmax: 0.117
    • Cmax_pos: 32
    • Smax: 0.64
    • Smax_pos: 5
    • Smean: 0.495
    • D: 0.328
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 446696643 NCBI
  • RefSeq: WP_000773989 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKLNQRYVKVFALYFVSIVTANIIVKNNNLIKTLIQTIAGYTVFAVGLKYLTKRKNK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS01120 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]