From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01390 [old locus tag: SACOL0274 ]
  • pan locus tag?: SAUPAN001178000
  • symbol: SACOL_RS01390
  • pan gene symbol?: esaB
  • synonym:
  • product: type VII secretion protein EsaB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS01390 [old locus tag: SACOL0274 ]
  • symbol: SACOL_RS01390
  • product: type VII secretion protein EsaB
  • replicon: chromosome
  • strand: +
  • coordinates: 313641..313922
  • length: 282
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (313641..313922) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    TTGTCATTTTTTCAATTCATAAAGGGAGACGAACGAAAAATGAATCAGCACGTAAAAGTA
    ACATTTGATTTTACTAATTATAATTACGGCACATATGACTTAGCAGTACCAGCATATTTA
    CCGATAAAAAACTTAATAGCTTTAGTATTGGATAGTTTGGACATTTCAATATTTGATGTC
    AATACACAAATTAAAGTGATGACGAAAGGTCAATTACTTGTTGAAAATGATCGACTCATT
    GATTATCAAATCGCTGATGGAGATATTTTGAAGTTACTATAG
    60
    120
    180
    240
    282

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS01390 [old locus tag: SACOL0274 ]
  • symbol: SACOL_RS01390
  • description: type VII secretion protein EsaB
  • length: 93
  • theoretical pI: 4.65437
  • theoretical MW: 10735.4
  • GRAVY: 0.0860215

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:
  • PFAM:
    Ubiquitin (CL0072) YukD; WXG100 protein secretion system (Wss), protein YukD (PF08817; HMM-score: 43.4)
    ubiquitin; Ubiquitin family (PF00240; HMM-score: 17.4)
    DMT (CL0184) Nuc_sug_transp; Nucleotide-sugar transporter (PF04142; HMM-score: 14.7)
    Ubiquitin (CL0072) Rad60-SLD; Ubiquitin-2 like Rad60 SUMO-like (PF11976; HMM-score: 14.3)
    no clan definedDUF5488; Family of unknown function (DUF5488) (PF17590; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 21
    • Cmax: 0.11
    • Cmax_pos: 67
    • Smax: 0.152
    • Smax_pos: 10
    • Smean: 0.122
    • D: 0.118
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_011446982 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSFFQFIKGDERKMNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS01390 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]