From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01590 [old locus tag: SACOL0315 ]
  • pan locus tag?: SAUPAN001242000
  • symbol: SACOL_RS01590
  • pan gene symbol?: nanE
  • synonym:
  • product: N-acetylmannosamine-6-phosphate 2-epimerase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS01590 [old locus tag: SACOL0315 ]
  • symbol: SACOL_RS01590
  • product: N-acetylmannosamine-6-phosphate 2-epimerase
  • replicon: chromosome
  • strand: +
  • coordinates: 350234..350902
  • length: 669
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (350234..350902) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGTTACCACATGGATTAATAGTATCTTGTCAGGCACTACCAGATGAACCATTGCATTCA
    TCTTTTATTATGTCGAAAATGGCATTAGCTGCGTATGAAGGTGGTGCTGTTGGTATTCGC
    GCAAATACTAAGGAAGACATTTTAGCAATTAAAGAAACGGTAGATTTACCAGTTATTGGC
    ATTGTGAAACGTGACTATGATCACTCAGATGTTTTCATTACTGCAACGTCAAAAGAAGTT
    GATGAACTGATAGAAAGCCAATGTGAAGTCATTGCATTGGATGCAACGTTACAGCAACGT
    CCGAAAGAAACGTTAGACGAATTAGTATCATATATTAGAACACATGCACCGAACGTTGAA
    ATCATGGCTGATATCGCGACCGTTGAAGAAGCTAAAAATGCCGCACGACTTGGCTTTGAT
    TATATTGGCACGACGTTACATGGCTATACTAGTTATACGCAAGGACAATTACTTTATCAA
    AATGACTTCCAATTTTTAAAAGATGTACTACAAAGTGTTGATGCAAAAGTTATTGCGGAA
    GGTAATGTCATTACACCGGATATGTATAAACGTGTGATGGACTTAGGCGTTCATTGTTCA
    GTCGTTGGTGGTGCGATAACACGACCAAAAGAAATTACGAAACGTTTTGTTCAAATTATG
    GAAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    669

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS01590 [old locus tag: SACOL0315 ]
  • symbol: SACOL_RS01590
  • description: N-acetylmannosamine-6-phosphate 2-epimerase
  • length: 222
  • theoretical pI: 4.57542
  • theoretical MW: 24545
  • GRAVY: -0.0189189

Function[edit source | edit]

  • reaction:
    EC 5.1.3.9?  ExPASy
    N-acylglucosamine-6-phosphate 2-epimeraseN-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate
  • TIGRFAM:
    3-hexulose-6-phosphate synthase (TIGR03128; EC 4.1.2.43; HMM-score: 28.3)
    Unknown functionGeneralputative TIM-barrel protein, nifR3 family (TIGR00737; HMM-score: 14.2)
    bifunctional HisA/TrpF protein (TIGR01919; EC 5.3.1.16,5.3.1.24; HMM-score: 13.3)
    Cellular processesCellular processesToxin production and resistanceradical SAM P-methyltransferase, PhpK family (TIGR04479; EC 2.1.-.-; HMM-score: 12.9)
  • TheSEED:
  • PFAM:
    TIM_barrel (CL0036) NanE; Putative N-acetylmannosamine-6-phosphate epimerase (PF04131; HMM-score: 219.6)
    IMPDH; IMP dehydrogenase / GMP reductase domain (PF00478; HMM-score: 19.8)
    Dus; Dihydrouridine synthase (Dus) (PF01207; HMM-score: 16.2)
    TMP-TENI; Thiamine monophosphate synthase (PF02581; HMM-score: 15.2)
    ThiG; Thiazole biosynthesis protein ThiG (PF05690; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.165
    • Ymax_pos: 31
    • Cmax: 0.187
    • Cmax_pos: 31
    • Smax: 0.235
    • Smax_pos: 35
    • Smean: 0.148
    • D: 0.158
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446859464 NCBI
  • RefSeq: WP_000936720 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLPHGLIVSCQALPDEPLHSSFIMSKMALAAYEGGAVGIRANTKEDILAIKETVDLPVIGIVKRDYDHSDVFITATSKEVDELIESQCEVIALDATLQQRPKETLDELVSYIRTHAPNVEIMADIATVEEAKNAARLGFDYIGTTLHGYTSYTQGQLLYQNDFQFLKDVLQSVDAKVIAEGNVITPDMYKRVMDLGVHCSVVGGAITRPKEITKRFVQIMED

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS01590 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]