From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01705 [old locus tag: SACOL0339 ]
  • pan locus tag?: SAUPAN001442000
  • symbol: SACOL_RS01705
  • pan gene symbol?: ssb1
  • synonym:
  • product: Single-stranded DNA-binding protein 2

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS01705 [old locus tag: SACOL0339 ]
  • symbol: SACOL_RS01705
  • product: Single-stranded DNA-binding protein 2
  • replicon: chromosome
  • strand: +
  • coordinates: 363651..364070
  • length: 420
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (363651..364070) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTAAACAGAACAGTATTAGTAGGGCGATTAACAAAAGACCCAGAATTAAGAAGCACG
    CCAAATGGCGTAAATGTAGGGACATTCACATTAGCAGTAAACAGAACATTTACAAATGCT
    CAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTATTCAAAAAACAAGCTGAAAAC
    GTTAAAAACTACCTTTCTAAAGGATCACTGGCAGGTGTAGACGGGCGATTACAAACACGC
    AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTT
    CAATTCTTAGAACCGAAGAATAACAACAAACAGAATAACCAACAACACAACGGACAAACT
    CAAACTGGTAATAATCCGTTCGACAATACCGAAGAAGACTTTTCTGACTTACCGTTCTGA
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS01705 [old locus tag: SACOL0339 ]
  • symbol: SACOL_RS01705
  • description: Single-stranded DNA-binding protein 2
  • length: 139
  • theoretical pI: 7.53655
  • theoretical MW: 15608.1
  • GRAVY: -0.815108

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairsingle-stranded DNA-binding protein (TIGR00621; HMM-score: 140.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairprimosomal replication protein PriB (TIGR04418; HMM-score: 34.2)
  • TheSEED:
  • PFAM:
    OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 123)
    tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 20.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.22
    • Ymax_pos: 43
    • Cmax: 0.248
    • Cmax_pos: 43
    • Smax: 0.426
    • Smax_pos: 11
    • Smean: 0.247
    • D: 0.231
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446857521 NCBI
  • RefSeq: WP_000934777 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRSYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEEDFSDLPF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS01705 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]