From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03330 [old locus tag: SACOL0645 ]
  • pan locus tag?: SAUPAN002451000
  • symbol: SACOL_RS03330
  • pan gene symbol?:
  • synonym:
  • product: DUF443 domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS03330 [old locus tag: SACOL0645 ]
  • symbol: SACOL_RS03330
  • product: DUF443 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 676266..676907
  • length: 642
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (676266..676907) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    GTGGAGATATTGCTTTGCGAGGTTAGAGTTGTAAACAAAAATCCCAGATATAGAATTATT
    AAATATAAAAACGACTATCTGATGATTGATTTAGTAAGCACCTGGTTAGTTTTGTTCTTT
    CCGTTTATTAATTGGTTAATACCAAAAAAATATGTCCAAATCAGCAGAGAAGATTTTGAT
    AATTTAAATATTGTCAAACCAGTTAAAAATAAAGCTTTATGGCCAGCTATAGGTAGCATA
    CTTTTATTTGGCACTATGTTTAGAGATAAAATATATATACCTGATTCTCATTTAGAAAAA
    AATTGCGTTATTATCATTTGTTCGGTTTTATTATTAAGTATTCTAGTGTTTTATATATAT
    TTAAATCAGAAAGTAAAGTTATCTATCTATAATGATCGGAGTAGCAATGGAAAAATTATG
    ATTTTTCCATCATTCAAGAATCTTTGCTTTGTACTATTTTCTTATTTTTTCTGTGGTGGA
    TTATCAATCATGTTCTTAGATGTTTTGATTAGTTTATCTATCCAAAATATTATAGTATTT
    ATTGCTTGGGTTATTATGACAATGCTATTTTTCTTTATAAATATGTCTTCAATAATAGAC
    AAAAAGATTCATGTTATATATTTAAGGTCATATAAATATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    642

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS03330 [old locus tag: SACOL0645 ]
  • symbol: SACOL_RS03330
  • description: DUF443 domain-containing protein
  • length: 213
  • theoretical pI: 9.77316
  • theoretical MW: 25226.4
  • GRAVY: 0.659155

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    tandem five-TM protein (TIGR01218; HMM-score: 173)
    Genetic information processingMobile and extrachromosomal element functionsProphage functionsphage holin, LL-H family (TIGR01673; HMM-score: 5.7)
  • TheSEED:
  • PFAM:
    no clan definedDUF443; Protein of unknown function (DUF443) (PF04276; HMM-score: 222.7)
    IgaA; Intracellular growth attenuator protein IgaA (PF07095; HMM-score: 13.4)
    Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.107
    • Ymax_pos: 19
    • Cmax: 0.112
    • Cmax_pos: 55
    • Smax: 0.154
    • Smax_pos: 9
    • Smean: 0.098
    • D: 0.104
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_000404342 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MEILLCEVRVVNKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIPKKYVQISREDFDNLNIVKPVKNKALWPAIGSILLFGTMFRDKIYIPDSHLEKNCVIIICSVLLLSILVFYIYLNQKVKLSIYNDRSSNGKIMIFPSFKNLCFVLFSYFFCGGLSIMFLDVLISLSIQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIYLRSYKY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS03330 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]