From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03465 [old locus tag: SACOL0670 ]
  • pan locus tag?: SAUPAN002481000
  • symbol: SACOL_RS03465
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS03465 [old locus tag: SACOL0670 ]
  • symbol: SACOL_RS03465
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 698052..698768
  • length: 717
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (698052..698768) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGCGTATTAACGATAAAATTTTACTAGAAAATATAGAAGATTACTTTAATCATAAAGGT
    TTATCACCGCATTTGATTGATGATATTAAAGAGAAAGTAATTACTGATATAAAAAATTCT
    GAAAAGAAAGATCAAGATTATATTGAATATAAAAGAAAATCTCCAGCACAAATCATATTA
    ATGATTCAAAGGAATTTGTTTGCTTTACAAATGAATCCAGTTATTTTCTTTATTATAAAC
    TTCATTCTCATATCCTATTTATATGATAAACAGTATGTTCAGTTTCAAGCTATTACTGGA
    ATGAGTCTATTTTATTGTTTAGTGATTTTTCCAATGACTATTGTTGTATACCTAAGGGTG
    TCTCAAAAGAATTACTTGCGTAGTAATAAAATAGAAATGATTATGGGTACAATTATCGCT
    ATCATATCCTTGTTATTAATTATATTACAAGCATTTAATATTACTTGGGGCGTTATACCA
    ATTACAAATTTTGGACATCAATTTTTCTTTTTCATTGGTATTATTTTAGTAATTGCCGGC
    ATATTTTATAAGCGACTTGAGTTTTCGGGAATCGGGTTATTATTTTGTCAAAAAACCGTC
    GATGCAATGATTCATAATCCACAATCAGCCCAGATTTTTTCATTAATTATATGGATATTA
    TTAGTAGTTCTAGTTATATATTTCACAATTAGATTATCTTCACGTACAAGATTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    717

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS03465 [old locus tag: SACOL0670 ]
  • symbol: SACOL_RS03465
  • description: hypothetical protein
  • length: 238
  • theoretical pI: 9.70229
  • theoretical MW: 27877.2
  • GRAVY: 0.592857

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 7.3)
    Hypothetical proteinsConservedTIGR00267 family protein (TIGR00267; HMM-score: 6.4)
  • TheSEED:
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.103
    • Ymax_pos: 43
    • Cmax: 0.121
    • Cmax_pos: 43
    • Smax: 0.111
    • Smax_pos: 58
    • Smean: 0.076
    • D: 0.093
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

  • GI: 447144877 NCBI
  • RefSeq: WP_001222133 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MRINDKILLENIEDYFNHKGLSPHLIDDIKEKVITDIKNSEKKDQDYIEYKRKSPAQIILMIQRNLFALQMNPVIFFIINFILISYLYDKQYVQFQAITGMSLFYCLVIFPMTIVVYLRVSQKNYLRSNKIEMIMGTIIAIISLLLIILQAFNITWGVIPITNFGHQFFFFIGIILVIAGIFYKRLEFSGIGLLFCQKTVDAMIHNPQSAQIFSLIIWILLVVLVIYFTIRLSSRTRL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS03465 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]