From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08610 [old locus tag: SACOL1688 ]
  • pan locus tag?: SAUPAN004238000
  • symbol: SACOL_RS08610
  • pan gene symbol?: dtd
  • synonym:
  • product: D-tyrosyl-tRNA(Tyr) deacylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08610 [old locus tag: SACOL1688 ]
  • symbol: SACOL_RS08610
  • product: D-tyrosyl-tRNA(Tyr) deacylase
  • replicon: chromosome
  • strand: -
  • coordinates: 1717645..1718097
  • length: 453
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1717645..1718097) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAGTAGTTGTACAAAGAGTTAAAGAAGCATCGGTGACGAATGATACATTAAATAAT
    CAAATCAAAAAAGGATATTGTTTATTAGTCGGTATCGGTCAGAACTCTACAGAGCAAGAT
    GCAGATGTAATTGCAAAGAAAATTGCTAATGCAAGATTATTTGAAGATGACAATAATAAA
    TTAAACTTTAATATCCAACAAATGAATGGTGAAATACTATCAGTTTCACAATTTACTCTC
    TATGCAGATGTAAAAAAAGGTAACCGTCCAGGTTTCTCAAATTCTAAAAATCCTGATCAA
    GCGGTAAAAATTTATGAGTATTTTAATGATGCGCTACGAGCGTATGGTCTTACTGTGAAA
    ACAGGTGAATTTGGAACACACATGAATGTTAGCATAAATAATGATGGTCCAGTCACTATT
    ATTTATGAAAGTCAGGACGGCAAAATTCAATGA
    60
    120
    180
    240
    300
    360
    420
    453

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08610 [old locus tag: SACOL1688 ]
  • symbol: SACOL_RS08610
  • description: D-tyrosyl-tRNA(Tyr) deacylase
  • length: 150
  • theoretical pI: 7.34423
  • theoretical MW: 16696.7
  • GRAVY: -0.502667

Function[edit source | edit]

  • reaction:
    EC 3.1.1.96?  ExPASy
    D-aminoacyl-tRNA deacylaseA D-aminoacyl-tRNA + H2O = a D-amino acid + tRNA
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA aminoacylationD-tyrosyl-tRNA(Tyr) deacylase (TIGR00256; EC 3.6.1.-; HMM-score: 175.4)
  • TheSEED:
  • PFAM:
    no clan definedTyr_Deacylase; D-Tyr-tRNA(Tyr) deacylase (PF02580; HMM-score: 171.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.174
    • Ymax_pos: 11
    • Cmax: 0.13
    • Cmax_pos: 42
    • Smax: 0.345
    • Smax_pos: 5
    • Smean: 0.288
    • D: 0.219
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446792727 NCBI
  • RefSeq: WP_000869983 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKVVVQRVKEASVTNDTLNNQIKKGYCLLVGIGQNSTEQDADVIAKKIANARLFEDDNNKLNFNIQQMNGEILSVSQFTLYADVKKGNRPGFSNSKNPDQAVKIYEYFNDALRAYGLTVKTGEFGTHMNVSINNDGPVTIIYESQDGKIQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08610 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]