From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS09620 [old locus tag: SACOL1875 ]
  • pan locus tag?: SAUPAN004576000
  • symbol: SACOL_RS09620
  • pan gene symbol?: epiD
  • synonym:
  • product: enterotoxin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS09620 [old locus tag: SACOL1875 ]
  • symbol: SACOL_RS09620
  • product: enterotoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 1927056..1927574
  • length: 519
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1927056..1927574) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGGAGAAAATGTATTGATTTGTTTGTGTGGCTCAGTTAATAGTATCAATATTAGCCAC
    TATATTATTGAATTAAAATCAAAATTTGATGAAGTAAATGTAATCGCGTCAACAAACGGT
    AGAAAGTTTATTAATGGTGAAATATTAAAGCAATTTTGCGATAACTATTATGACGAATTT
    GAAGACCCTTTTTTAAATCATGTAGATATAGCAAATAAACATGACAAGATTATTATTTTA
    CCTGCGACTTCTAATACGATTAATAAAATTGCAAATGGTATATGTGACAATTTATTATTA
    ACTATTTGTCATACAGCTTTTGAAAAACTTTCTATATTTCCAAATATGAATTTACGAATG
    TGGGAAAATCCAGTTACTCAAAATAATATTCGATTATTAAAAGATTATGGTGTATCAATA
    TATCCAGCAAATATTTCAGAAAGTTATGAATTAGCGTCAAAAACATTTAAAAAGAATGTT
    GTCGCACCTGAACCATATAAAGTTCTGGAATTCATTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    519

Protein[edit source | edit]

Protein Data Bank: 3QJG

General[edit source | edit]

  • locus tag: SACOL_RS09620 [old locus tag: SACOL1875 ]
  • symbol: SACOL_RS09620
  • description: enterotoxin
  • length: 172
  • theoretical pI: 5.63756
  • theoretical MW: 19593.4
  • GRAVY: -0.0581395

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Aphosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase (TIGR00521; EC 4.1.1.36,6.3.2.5; HMM-score: 97.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Aphosphopantothenoylcysteine decarboxylase (TIGR02113; EC 4.1.1.36; HMM-score: 73.2)
    Unknown functionEnzymes of unknown specificitypolyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases (TIGR00421; EC 4.1.1.-; HMM-score: 28.4)
    MetabolismEnergy metabolismElectron transportarchaeoflavoprotein AfpA (TIGR02699; HMM-score: 26)
    Unknown functionGeneralarchaeoflavoprotein, MJ0208 family (TIGR02700; HMM-score: 25.9)
    Cellular processesCellular processesSporulation and germinationdipicolinic acid synthetase, B subunit (TIGR02852; HMM-score: 16)
  • TheSEED:
  • PFAM:
    no clan definedFlavoprotein; Flavoprotein (PF02441; HMM-score: 104.6)
    His-Me_finger (CL0263) HNH_2; HNH endonuclease (PF13391; HMM-score: 16.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.154
    • Ymax_pos: 27
    • Cmax: 0.145
    • Cmax_pos: 37
    • Smax: 0.307
    • Smax_pos: 21
    • Smean: 0.166
    • D: 0.159
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446426584 NCBI
  • RefSeq: WP_000504439 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MGENVLICLCGSVNSINISHYIIELKSKFDEVNVIASTNGRKFINGEILKQFCDNYYDEFEDPFLNHVDIANKHDKIIILPATSNTINKIANGICDNLLLTICHTAFEKLSIFPNMNLRMWENPVTQNNIRLLKDYGVSIYPANISESYELASKTFKKNVVAPEPYKVLEFI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS09620 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]