Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12150 [old locus tag: SACOL2310 ]
  • pan locus tag?: SAUPAN005797000
  • symbol: SACOL_RS12150
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12150 [old locus tag: SACOL2310 ]
  • symbol: SACOL_RS12150
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2372761..2373117
  • length: 357
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2372761..2373117) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGTTAAAACAAATACTGCTACGTGCTACAAAAATATCGGTACTCTTTGCTGTAGCATTT
    TTCATCATAAATTATATCGGTATGGAAAAACCTGACATCCTATATTTAGTTGGAAGAACT
    ATTATTGCAACACTTGCTTTCATACTCATTTGTCTTACAGTATTTACTATTATTAATTCT
    CCAGAGCGCAAGATTAAACTCGGTACGACTTTACCGATTGCATTAATTATTGGTATCATT
    TTCGGCGCCATATTTTTAACGGTACAAATCGGTGTCATCACTGGGTTAATCATCGGTGTG
    ATTGCTACGTTTATTTGGGAATTGATTGAAAAAAATAAAGGAGGTCGTTCATCATGA
    60
    120
    180
    240
    300
    357

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12150 [old locus tag: SACOL2310 ]
  • symbol: SACOL_RS12150
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 10.5457
  • theoretical MW: 12948.8
  • GRAVY: 1.2178

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesConjugationtype IV conjugative transfer system protein TraL (TIGR02762; HMM-score: 7.5)
    oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 2.8)
  • TheSEED:
  • PFAM:
    no clan definedDUF4203; Domain of unknown function (DUF4203) (PF13886; HMM-score: 11.8)
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 11.8)
    2heme_cytochrom (CL0328) DUF2427; Domain of unknown function (DUF2427) (PF10348; HMM-score: 10)
    no clan definedDUF4491; Domain of unknown function (DUF4491) (PF14898; HMM-score: 8.7)
    DUF4408; Domain of unknown function (DUF4408) (PF14364; HMM-score: 7.8)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 7.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.23
    • Ymax_pos: 11
    • Cmax: 0.127
    • Cmax_pos: 64
    • Smax: 0.654
    • Smax_pos: 3
    • Smean: 0.532
    • D: 0.348
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

  • GI: 446840408 NCBI
  • RefSeq: WP_000917664 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLKQILLRATKISVLFAVAFFIINYIGMEKPDILYLVGRTIIATLAFILICLTVFTIINSPERKIKLGTTLPIALIIGIIFGAIFLTVQIGVITGLIIGVIATFIWELIEKNKGGRSS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12150 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]