From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12545 [old locus tag: SACOL2391 ]
  • pan locus tag?: SAUPAN005924000
  • symbol: SACOL_RS12545
  • pan gene symbol?: nreA
  • synonym:
  • product: GAF domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12545 [old locus tag: SACOL2391 ]
  • symbol: SACOL_RS12545
  • product: GAF domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2449966..2450418
  • length: 453
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2449966..2450418) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGACACCAGAAGCAATAATTGAAGATCGTAGATTTCAAGAGACATTAGATAAAATACGC
    AAAGAAGAGGGTTATGATTTTGCGGCAATCGCTTTCTATGAATCTAACAAACCATCATCT
    CCAATAAAATGGCACTATGTTTCAGGTAATAAAAATAATCGATTTAAATTGATTATTTTA
    AGAAAAGGTCGTGGATTAGCTGGAACTGTTATGAAAACAGGAAAGCGTATGGTAATAGCC
    AATGTTGGTTTAGCTTTAGGGCCTGAAGAAAAGATTGACTATCCAATTTTATTGAGCGAA
    TCATTAACAGCAGTTTTAGCAGTGCCGCTTTGGTATAAGAATCAAGTGTATGGCGTACTA
    TTATTTGGTCAAAGAGATGGTCGTCCTTTACCAAAAATATTTGATAATGATGATATTCAA
    CGTAAGTTTGGTATTTTCAATGATGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    453

Protein[edit source | edit]

Protein Data Bank: 4PAU

General[edit source | edit]

  • locus tag: SACOL_RS12545 [old locus tag: SACOL2391 ]
  • symbol: SACOL_RS12545
  • description: GAF domain-containing protein
  • length: 150
  • theoretical pI: 9.92029
  • theoretical MW: 17149.7
  • GRAVY: -0.381333

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismCentral intermediary metabolismNitrogen fixationNif-specific regulatory protein (TIGR01817; HMM-score: 11.6)
    Signal transductionRegulatory functionsDNA interactionsNif-specific regulatory protein (TIGR01817; HMM-score: 11.6)
  • TheSEED:
  • PFAM:
    GAF (CL0161) GAF_2; GAF domain (PF13185; HMM-score: 34.5)
    GAF; GAF domain (PF01590; HMM-score: 26.6)
    GAF_3; GAF domain (PF13492; HMM-score: 20.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.11
    • Ymax_pos: 67
    • Cmax: 0.112
    • Cmax_pos: 44
    • Smax: 0.139
    • Smax_pos: 57
    • Smean: 0.079
    • D: 0.097
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446109078 NCBI
  • RefSeq: WP_000186933 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTPEAIIEDRRFQETLDKIRKEEGYDFAAIAFYESNKPSSPIKWHYVSGNKNNRFKLIILRKGRGLAGTVMKTGKRMVIANVGLALGPEEKIDYPILLSESLTAVLAVPLWYKNQVYGVLLFGQRDGRPLPKIFDNDDIQRKFGIFNDDK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12545 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]