From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS14195 [old locus tag: SACOL2714 ]
  • pan locus tag?: SAUPAN006447000
  • symbol: SACOL_RS14195
  • pan gene symbol?: pcp
  • synonym:
  • product: pyrrolidone-carboxylate peptidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS14195 [old locus tag: SACOL2714 ]
  • symbol: SACOL_RS14195
  • product: pyrrolidone-carboxylate peptidase
  • replicon: chromosome
  • strand: +
  • coordinates: 2786669..2787307
  • length: 639
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2786669..2787307) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGCACATTTTAGTAACAGGGTTTGCGCCTTTTGACAATCAAAATATCAATCCCTCATGG
    GAAGCTGTGACTCAACTAGAAGATATTATTGGCACACATACAATCGATAAATTAAAACTA
    CCAACCTCTTTTAAGAAAGTAGATAATATTATAAATAAAACGTTGGCATCTAATCATTAT
    GATGTTGTACTAGCTATAGGACAAGCTGGTGGTAGAAATGCCATTACCCCAGAACGTGTC
    GCCATTAATATTGATGATGCACGTATTCCAGATAATGATGATTTTCAACCTATTGATCAA
    GCCATTCACTTAGACGGTGCGCCAGCTTATTTTTCAAATTTACCAGTTAAAGCAATGACT
    CAAAGTATTATTAATCAAGGACTTCCTGGAGCACTTTCAAATAGCGCAGGTACATTTGTT
    TGTAATCACACACTTTATCACTTAGGTTATTTACAAGATAAGCATTACCCTCACCTACGA
    TTCGGATTTATTCATGTGCCATACATACCAGAGCAGGTCATTGGTAAACCCGATACACCA
    TCTATGCCATTAGAAAAGATAGTTGCAGGTTTGACTGCAGCCATTGAAGCTATTTCTAAT
    GATGAGGATTTACACCTAGCCCTGGGCACAACGGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    639

Protein[edit source | edit]

Protein Data Bank: 3GIU

General[edit source | edit]

  • locus tag: SACOL_RS14195 [old locus tag: SACOL2714 ]
  • symbol: SACOL_RS14195
  • description: pyrrolidone-carboxylate peptidase
  • length: 212
  • theoretical pI: 5.17512
  • theoretical MW: 23167.1
  • GRAVY: -0.107075

Function[edit source | edit]

  • reaction:
    EC 3.4.19.3?  ExPASy
    Pyroglutamyl-peptidase IRelease of an N-terminal pyroglutamyl group from a polypeptide, the second amino acid generally not being Pro
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidespyroglutamyl-peptidase I (TIGR00504; EC 3.4.19.3; HMM-score: 225.3)
  • TheSEED:
  • PFAM:
    PgaPase (CL0379) Peptidase_C15; Pyroglutamyl peptidase (PF01470; HMM-score: 313.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 22
    • Cmax: 0.16
    • Cmax_pos: 22
    • Smax: 0.203
    • Smax_pos: 18
    • Smean: 0.129
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446469979 NCBI
  • RefSeq: WP_000547833 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MHILVTGFAPFDNQNINPSWEAVTQLEDIIGTHTIDKLKLPTSFKKVDNIINKTLASNHYDVVLAIGQAGGRNAITPERVAINIDDARIPDNDDFQPIDQAIHLDGAPAYFSNLPVKAMTQSIINQGLPGALSNSAGTFVCNHTLYHLGYLQDKHYPHLRFGFIHVPYIPEQVIGKPDTPSMPLEKIVAGLTAAIEAISNDEDLHLALGTTE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS14195 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]