From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00314
  • pan locus tag?: SAUPAN001868000
  • symbol: SAOUHSC_00314
  • pan gene symbol?: mepR
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00314
  • symbol: SAOUHSC_00314
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 328838..329257
  • length: 420
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCT
    GATCAAAAGTTAGAGCAATTTGATATTACAAATGAGCAAGGTCATACGTTAGGTTATCTT
    TATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
    GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTAT
    GTCGATGCACAAGATACGAGAAGAAAGAATATAGGGCTGACTACCTCTGGGATTAAACTC
    GTAGAAGCATTCACTTCGATATTTGATGAAATGGAACAAACACTCGTATCGCAGTTATCT
    GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00314
  • symbol: SAOUHSC_00314
  • description: hypothetical protein
  • length: 139
  • theoretical pI: 6.26722
  • theoretical MW: 16172.2
  • GRAVY: -0.669784

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.9)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 22.8)
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 20.4)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.8)
    Signal transductionRegulatory functionsDNA interactionsaminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 13.6)
  • TheSEED:  
    Transcriptional regulator, MarR family 
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 38.6)
    MarR; MarR family (PF01047; HMM-score: 38.1)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 22.9)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 21.2)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 20.3)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 18.4)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.8)
    no clan definedDUF445; Protein of unknown function (DUF445) (PF04286; HMM-score: 17.6)
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)
    HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.8)
    B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 16.5)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.3)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.2)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 15.2)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.4)
    DUF1670; Protein of unknown function (DUF1670) (PF07900; HMM-score: 14.3)
    Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 13.1)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.7)
    no clan definedVps4_C; Vps4 C terminal oligomerisation domain (PF09336; HMM-score: 12.4)
    HTH (CL0123) HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.144
    • Ymax_pos: 21
    • Cmax: 0.135
    • Cmax_pos: 21
    • Smax: 0.293
    • Smax_pos: 20
    • Smean: 0.135
    • D: 0.14
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SAOUHSC_00314 (MepR*)
    MepR* (TF) important in Multidrug resistanceRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]