From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01055a
  • pan locus tag?:
  • symbol: SAOUHSC_01055a
  • pan gene symbol?:
  • synonym:
  • product: membrane protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01055a
  • symbol: SAOUHSC_01055a
  • product: membrane protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1023369..1023560
  • length: 192
  • essential: unknown

Accession numbers[edit source | edit]

  • Gene ID: 16830699 NCBI
  • RefSeq: YP_008530239 NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAAACAAAAAAAATCTAAAAATATCTTTTGGGTATTTTCTATATTAGCTGTTGTTTTC
    TTAGTATTATTTAGTTTTGCTGTTGGTGCATCAAATGTACCAATGATGATTTTAACATTT
    ATATTACTCGTTGCAACCTTTGGAATTGGATTTACTACAAAGAAAAAATATCGAGAAAAC
    GATTGGCTATAA
    60
    120
    180
    192

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01055a
  • symbol: SAOUHSC_01055a
  • description: membrane protein
  • length: 63
  • theoretical pI: 10.9505
  • theoretical MW: 7249.77
  • GRAVY: 0.779365

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    early transcribed membrane protein (ETRAMP) family (TIGR01495; HMM-score: 14.6)
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 12.7)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 12.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EssA (TIGR03927; HMM-score: 6.5)
  • TheSEED:
  • PFAM:
    no clan definedDUF5325; Family of unknown function (DUF5325) (PF17259; HMM-score: 72.2)
    DUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 18.8)
    DUF4231; Protein of unknown function (DUF4231) (PF14015; HMM-score: 17)
    DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 16.6)
    DUF4133; Domain of unknown function (DUF4133) (PF13571; HMM-score: 14.8)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 14.1)
    DUF5392; Family of unknown function (DUF5392) (PF17370; HMM-score: 14)
    Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 13.5)
    no clan definedDUF3754; Protein of unknown function (DUF3754) (PF12576; HMM-score: 13.1)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13)
    ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 12.9)
    PHO4; Phosphate transporter family (PF01384; HMM-score: 11.8)
    PBP_N; Penicillin-binding protein N-terminus (PF17093; HMM-score: 11.6)
    SNARE; SNARE domain (PF05739; HMM-score: 10.2)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 8.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.251
    • Ymax_pos: 30
    • Cmax: 0.207
    • Cmax_pos: 30
    • Smax: 0.694
    • Smax_pos: 17
    • Smean: 0.459
    • D: 0.332
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 542123272 NCBI
  • RefSeq: YP_008530239 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYRENDWL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAOUHSC_01055a no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]