From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_1342a
  • pan locus tag?:
  • symbol: SAOUHSC_1342a
  • pan gene symbol?:
  • synonym:
  • product: large-conductance mechanosensitive channel

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_1342a
  • symbol: SAOUHSC_1342a
  • product: large-conductance mechanosensitive channel
  • replicon: chromosome
  • strand: -
  • coordinates: 1284057..1284419
  • length: 363
  • essential: unknown

Accession numbers[edit source | edit]

  • Gene ID: 16830701 NCBI
  • RefSeq: YP_008530241 NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTAAAAGAATTCAAAGAGTTCGCCTTAAAAGGTAACGTCTTAGATTTAGCAATTGCT
    GTTGTGATGGGTGCAGCTTTCAACAAGATTATATCTTCATTAGTAGAAAATATCATTATG
    CCATTAATTGGTAAAATTTTCGGATCAGTTGATTTTGCTAAAGAATGGTCATTCTGGGGT
    ATTAAATACGGTTTATTTATCCAATCTGTTATCGACTTTATTATCATCGCGTTTGCTTTA
    TTCATCTTTGTTAAGATTGCAAATACATTAATGAAGAAAGAAGAAGCCGAAGAAGAAGCA
    GTTGTGGAAGAAAATGTTGTGTTATTAACTGAAATCAGAGATTTATTACGTGAGAAAAAA
    TAA
    60
    120
    180
    240
    300
    360
    363

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_1342a
  • symbol: SAOUHSC_1342a
  • description: large-conductance mechanosensitive channel
  • length: 120
  • theoretical pI: 4.73922
  • theoretical MW: 13616.2
  • GRAVY: 0.641667

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesAdaptations to atypical conditionslarge conductance mechanosensitive channel protein (TIGR00220; HMM-score: 126.6)
  • TheSEED:
  • PFAM:
    no clan definedMscL; Large-conductance mechanosensitive channel, MscL (PF01741; HMM-score: 136.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.147
    • Ymax_pos: 26
    • Cmax: 0.161
    • Cmax_pos: 54
    • Smax: 0.24
    • Smax_pos: 12
    • Smean: 0.177
    • D: 0.159
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAOUHSC_1342a no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]