From AureoWiki
Jump to: navigation, search
04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 27-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP006 [new locus tag: SA_RS00025 ]
  • pan locus tag?:
  • symbol: cadX
  • pan gene symbol?:
  • synonym:
  • product: CadX

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAP006 [new locus tag: SA_RS00025 ]
  • symbol: cadX
  • product: CadX
  • replicon: pN315
  • strand: +
  • coordinates: 5137..5484
  • length: 348
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAGTTATGAAAATACTTGTGATGTGATCTGTGTACATGAGGATAAAGTTAACAATGCT
    TTAAGTTTTTTAGAAGATGATAAATCTAAGAAATTACTTAACATTTTAGAAAAAATTTGT
    GATGAGAAGAAATTGAAAATCATATTATCTTTGATTAAAGAAGATGAGTTGTGTGTTTGT
    GATATTTCTTTGATATTGAAAATGAGTGTTGCTTCAACTTCACATCATTTAAGGCTTTTA
    TATAAAAATGAGGTACTTGATTTTTATAAAGATGGAAAGATGGCATATTATTTTATTAAA
    GACGATGAAATAAGAGAGTTTTTCTCTAAAAATCATGAGGGTTTTTGA
    60
    120
    180
    240
    300
    348

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAP006 [new locus tag: SA_RS00025 ]
  • symbol: CadX
  • description: CadX
  • length: 115
  • theoretical pI: 5.251
  • theoretical MW: 13517.6
  • GRAVY: -0.231304

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsCations and iron carrying compoundscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 15.9)
    Signal transductionRegulatory functionsDNA interactionscopper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 15.9)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsCadmium resistance Cadmium efflux system accessory protein 
  • PFAM:
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 51.3)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.102
    • Ymax_pos: 30
    • Cmax: 0.109
    • Cmax_pos: 26
    • Smax: 0.142
    • Smax_pos: 18
    • Smean: 0.073
    • D: 0.091
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 16119206 NCBI
  • RefSeq: NP_395542 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSYENTCDVICVHEDKVNNALSFLEDDKSKKLLNILEKICDEKKLKIILSLIKEDELCVCDISLILKMSVASTSHHLRLLYKNEVLDFYKDGKMAYYFIKDDEIREFFSKNHEGF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]