From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

⊟Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS034 [new locus tag: SA_RS05665 ]
  • pan locus tag?: SAUPAN003393000
  • symbol: SAS034
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit source | edit]

⊟Gene[edit source | edit]

⊟General[edit source | edit]

  • type: CDS
  • locus tag: SAS034 [new locus tag: SA_RS05665 ]
  • symbol: SAS034
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1132896..1133033
  • length: 138
  • essential: no DEG other strains

⊟Accession numbers[edit source | edit]

⊟Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit source | edit]

  • 1
    61
    121
    ATTGTTGATAACCCTATATGGTTGAATCATGTTGATTATTTGGTTAAAAGTGTATTATTA
    AAAAGTATAAAATTAAGATTCCAAGAAGTCAGGAAATTTGAAATTTTAGTTAAAATCATG
    AATCGTATACATATTTAA
    60
    120
    138

⊟Protein[edit source | edit]

⊟General[edit source | edit]

  • locus tag: SAS034 [new locus tag: SA_RS05665 ]
  • symbol: SAS034
  • description: hypothetical protein
  • length: 45
  • theoretical pI: 10.6845
  • theoretical MW: 5490.65
  • GRAVY: 0.257778

⊟Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01107850: hypothetical protein 
  • PFAM:
    no clan definedDUF1803; Domain of unknown function (DUF1803) (PF08820; HMM-score: 13.9)

⊟Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

⊟Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.091
    • Ymax_pos: 44
    • Cmax: 0.104
    • Cmax_pos: 26
    • Smax: 0.097
    • Smax_pos: 33
    • Smean: 0.061
    • D: 0.079
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit source | edit]

⊟Protein sequence[edit source | edit]

  • MVDNPIWLNHVDYLVKSVLLKSIKLRFQEVRKFEILVKIMNRIHI

⊟Experimental data[edit source | edit]

  • experimentally validated: no data available

⊟Expression & Regulation[edit source | edit]

⊟Operon[edit source | edit]

⊟Regulation[edit source | edit]

  • sigma factor:
  • regulator:

⊟Transcription pattern[edit source | edit]

⊟Protein synthesis (provided by Aureolib)[edit source | edit]

⊟Protein stability[edit source | edit]

  • half-life: no data available

⊟Biological Material[edit source | edit]

⊟Mutants[edit source | edit]

⊟Expression vector[edit source | edit]

⊟lacZ fusion[edit source | edit]

⊟GFP fusion[edit source | edit]

⊟two-hybrid system[edit source | edit]

⊟FLAG-tag construct[edit source | edit]

⊟Antibody[edit source | edit]

⊟Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

⊟Literature[edit source | edit]

⊟References[edit source | edit]

⊟Relevant publications[edit source | edit]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAS034&oldid=89749"