From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS059
  • pan locus tag?: SAUPAN005036000
  • symbol: SAS059
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAS059
  • symbol: SAS059
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2011001..2011135
  • length: 135
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCTAATGATTACAATTAGTACCATG
    TTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAATTA
    AGCAATAAAAAATAA
    60
    120
    135

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAS059
  • symbol: SAS059
  • description: hypothetical protein
  • length: 44
  • theoretical pI: 11.7217
  • theoretical MW: 5029.33
  • GRAVY: 1.00909

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Phage protein 
  • PFAM:
    no clan definedHol_Tox; Putative Holin-like Toxin (Hol-Tox) (PF16935; HMM-score: 29.9)
    DUF3481; C-terminal domain of neuropilin glycoprotein (PF11980; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.16
    • Ymax_pos: 11
    • Cmax: 0.103
    • Cmax_pos: 44
    • Smax: 0.332
    • Smax_pos: 3
    • Smean: 0.251
    • D: 0.195
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]