From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000007000
  • symbol?: dnaN
  • description?: DNA polymerase III subunit beta

      descriptions from strain specific annotations:

    • DNA polymerase III subunit beta
    • DNA polymerase III beta subunit
    • DNA-directed DNA polymerase beta subunit
    • DNA-directed DNA polymerase III subunit beta
    • DNA polymerase III, beta subunit
    • DNA-directed DNA polymerase beta subunit, DnaN
  • strand?: +
  • coordinates?: 7253..8386
  • synteny block?: BlockID0000040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0002 (dnaN)
    N315:
    SA0002 (dnaN)
    NCTC8325:
    Newman:
    NWMN_0002 (dnaN)
    USA300_FPR3757:
    04-02981:
    SA2981_0002 (dnaN)
    08BA02176:
    C248_0002 (dnaN)
    11819-97:
    MS7_0002 (dnaN)
    71193:
    ST398NM01_0002
    ECT-R 2:
    ECTR2_2 (dnaN)
    ED133:
    SAOV_0002 (dnaN)
    ED98:
    SAAV_0002 (dnaN)
    HO 5096 0412:
    SAEMRSA15_00020 (dnaN)
    JH1:
    SaurJH1_0002
    JH9:
    SaurJH9_0002
    JKD6008:
    SAA6008_00002 (dnaN)
    JKD6159:
    SAA6159_00002 (dnaN)
    LGA251:
    SARLGA251_00020 (dnaN)
    M013:
    M013TW_0002
    MRSA252:
    SAR0002 (dnaN)
    MSHR1132:
    SAMSHR1132_00020
    MSSA476:
    SAS0002
    Mu3:
    SAHV_0002 (dnaN)
    Mu50:
    SAV0002 (dnaN)
    MW2:
    MW0002 (dnaN)
    RF122:
    SAB0002 (dnaN)
    ST398:
    SAPIG0002 (dnaN)
    T0131:
    SAT0131_00002
    TCH60:
    HMPREF0772_10466 (dnaN)
    TW20:
    SATW20_00020 (dnaN)
    USA300_TCH1516:
    USA300HOU_0002 (dnaN)
    VC40:
    SAVC_00010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPK
    N315            MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPK
    NCTC8325        MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPK
    Newman          MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPK
    USA300_FPR3757  MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVILTGSDSEISIEITIPK
                    ************************************************************

    COL             TVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLD
    N315            TVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLD
    NCTC8325        TVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLD
    Newman          TVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLD
    USA300_FPR3757  TVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQTLITSGHSEFNLSGLD
                    ************************************************************

    COL             PDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTAT
    N315            PDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTAT
    NCTC8325        PDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTAT
    Newman          PDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTAT
    USA300_FPR3757  PDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVLTGVNWLIQENELICTAT
                    ************************************************************

    COL             DSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNF
    N315            DSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNF
    NCTC8325        DSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNF
    Newman          DSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNF
    USA300_FPR3757  DSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDIDIFFASNQVLFKVGNVNF
                    ************************************************************

    COL             ISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVE
    N315            ISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVE
    NCTC8325        ISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVE
    Newman          ISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVE
    USA300_FPR3757  ISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLLAREGGNNVIKLSTGDDVVE
                    ************************************************************

    COL             LSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILK
    N315            LSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILK
    NCTC8325        LSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILK
    Newman          LSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILK
    USA300_FPR3757  LSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKAIDNDEVEVEFFGTMKPFILK
                    ************************************************************

    COL             PKGDDSVTQLILPIRTY
    N315            PKGDDSVTQLILPIRTY
    NCTC8325        PKGDDSVTQLILPIRTY
    Newman          PKGDDSVTQLILPIRTY
    USA300_FPR3757  PKGDDSVTQLILPIRTY
                    *****************