From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000009000
  • symbol?:
  • description?: S4 region, YaaA

      descriptions from strain specific annotations:

    • S4 region, YaaA
    • S4 region YaaA family protein
    • S4 domain protein YaaA
    • S4 domain-containing protein YaaA
    • RNA-binding S4 protein
  • strand?: +
  • coordinates?: 9515..9760
  • synteny block?: BlockID0000060
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0003
    08BA02176:
    C248_0003
    11819-97:
    MS7_0003 (yaaA)
    71193:
    ST398NM01_0003
    ECT-R 2:
    ECTR2_3
    ED133:
    SAOV_0003
    ED98:
    SAAV_0003
    HO 5096 0412:
    SAEMRSA15_00030
    JH1:
    SaurJH1_0003
    JH9:
    SaurJH9_0003
    JKD6008:
    SAA6008_00003
    JKD6159:
    SAA6159_00003
    LGA251:
    SARLGA251_00030
    M013:
    M013TW_0004
    MRSA252:
    SAR0003
    MSHR1132:
    SAMSHR1132_00030
    MSSA476:
    SAS0003
    Mu3:
    SAHV_0003
    Mu50:
    SAV0003
    MW2:
    MW0003
    RF122:
    SAB0003
    ST398:
    SAPIG0003 (yaaA)
    T0131:
    SAT0131_00003 (birA)
    TCH60:
    HMPREF0772_10465 (yaaA)
    TW20:
    SATW20_00030
    USA300_TCH1516:
    USA300HOU_0003
    VC40:
    SAVC_00015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDR
    N315            MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDR
    NCTC8325        MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDR
    USA300_FPR3757  MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLINGVRETRRGKKLEHQDR
                    ************************************************************

    COL             IDIPELPEDAGSFLIIHQGEQ
    N315            IDIPELPEDAGSFLIIHQGEQ
    NCTC8325        IDIPELPEDAGSFLIIHQGEQ
    USA300_FPR3757  IDIPELPEDAGSFLIIHQGEQ
                    *********************