From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000011000
  • symbol?: gyrB
  • description?: DNA gyrase subunit B

      descriptions from strain specific annotations:

    • DNA gyrase subunit B
    • DNA gyrase, B subunit
    • DNA gyrase B subunit
    • DNA topoisomerase (ATP-hydrolyzing) subunit B
    • DNA topoisomerase (ATP-hydrolyzing) subunit B, GyrB
    • DNA topoisomerase subunit B
  • strand?: +
  • coordinates?: 10879..12813
  • synteny block?: BlockID0000080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0005 (gyrB)
    N315:
    SA0005 (gyrB)
    NCTC8325:
    Newman:
    NWMN_0004 (gyrB)
    USA300_FPR3757:
    04-02981:
    SA2981_0005 (gyrB)
    08BA02176:
    C248_0005 (gyrB)
    11819-97:
    MS7_0005 (gyrB)
    71193:
    ST398NM01_0005
    ECT-R 2:
    ECTR2_5 (gyrB)
    ED133:
    SAOV_0005 (gyrB)
    ED98:
    SAAV_0005 (gyrB)
    HO 5096 0412:
    SAEMRSA15_00050 (gyrB)
    JH1:
    SaurJH1_0005
    JH9:
    SaurJH9_0005
    JKD6008:
    SAA6008_00005 (gyrB)
    JKD6159:
    SAA6159_00005 (gyrB)
    LGA251:
    SARLGA251_00050 (gyrB)
    M013:
    M013TW_0006
    MRSA252:
    SAR0005 (gyrB)
    MSHR1132:
    SAMSHR1132_00050
    MSSA476:
    SAS0005
    Mu3:
    SAHV_0005 (gyrB)
    Mu50:
    SAV0005 (gyrB)
    MW2:
    MW0005 (gyrB)
    RF122:
    SAB0005 (gyrB)
    ST398:
    SAPIG0005 (gyrB)
    T0131:
    SAT0131_00005
    TCH60:
    HMPREF0772_10463 (gyrB)
    TW20:
    SATW20_00050 (gyrB)
    USA300_TCH1516:
    USA300HOU_0005 (gyrB)
    VC40:
    SAVC_00025 (gyrB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVTALSDVNNTDNYGAGQIQVLEGLEAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEAL
    N315            MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEAL
    NCTC8325        MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEAL
    Newman          MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEAL
    USA300_FPR3757  MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEAL
                    ***************************.********************************

    COL             AGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVS
    N315            AGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVS
    NCTC8325        AGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVS
    Newman          AGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVS
    USA300_FPR3757  AGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVS
                    *****:******************************************************

    COL             GGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKAD
    N315            GGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKAD
    NCTC8325        GGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKAD
    Newman          GGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKAD
    USA300_FPR3757  GGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKAD
                    ************************************************************

    COL             GEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELL
    N315            GEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELL
    NCTC8325        GEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELL
    Newman          GEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELL
    USA300_FPR3757  GEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELL
                    ************************************************************

    COL             NENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRAL
    N315            NENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRAL
    NCTC8325        NENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRAL
    Newman          NENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRAL
    USA300_FPR3757  NENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRAL
                    ************************************************************

    COL             TRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVV
    N315            TRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVV
    NCTC8325        TRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVV
    Newman          TRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVV
    USA300_FPR3757  TRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVV
                    ************************************************************

    COL             DKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLAD
    N315            DKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLAD
    NCTC8325        DKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLAD
    Newman          DKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLAD
    USA300_FPR3757  DKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLAD
                    ************************************************************

    COL             CSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQ
    N315            CSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQ
    NCTC8325        CSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQ
    Newman          CSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQ
    USA300_FPR3757  CSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQ
                    ************************************************************

    COL             MITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIA
    N315            MITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIA
    NCTC8325        MITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIA
    Newman          MITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIA
    USA300_FPR3757  MITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIA
                    ************************************************************

    COL             QPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEH
    N315            QPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEH
    NCTC8325        QPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEH
    Newman          QPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEH
    USA300_FPR3757  QPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEH
                    ************************************************************

    COL             RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
    N315            RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
    NCTC8325        RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
    Newman          RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
    USA300_FPR3757  RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
                    ********************************************