From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000023000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 23273..24268
  • synteny block?: BlockID0000200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0013
    08BA02176:
    C248_0013
    11819-97:
    MS7_0013
    71193:
    ST398NM01_0013
    ECT-R 2:
    ECTR2_13
    ED133:
    SAOV_0013
    ED98:
    SAAV_0015
    HO 5096 0412:
    SAEMRSA15_00130
    JH1:
    SaurJH1_0013
    JH9:
    SaurJH9_0013
    JKD6008:
    SAA6008_00013
    JKD6159:
    SAA6159_00013
    LGA251:
    SARLGA251_00130
    M013:
    M013TW_0014
    MRSA252:
    SAR0013
    MSHR1132:
    SAMSHR1132_00130
    MSSA476:
    SAS0013
    Mu3:
    SAHV_0013
    Mu50:
    SAV0013
    MW2:
    MW0013
    RF122:
    SAB0013
    ST398:
    SAPIG0013
    T0131:
    SAT0131_00015 (aroC)
    TCH60:
    HMPREF0772_10455
    TW20:
    SATW20_00130
    USA300_TCH1516:
    USA300HOU_0013
    VC40:
    SAVC_00065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------------MFSKIQPKATIIATIALVFVALALYLVPGLGLIFAL
    N315            MYKLLISIKEVKIIAIVKNMGVAYVFSKIQPKATIIATITLVFVALALYLVPGLGLIFAL
    NCTC8325        -------------------MGVAYVFSKIQPKATIIATIALVFVALALYLVPGLGLIFAL
    Newman          ---MLIFIKEVKIIAIVKNMGVAYVFSKIQPKATIIATIALVFVALALYLVPGLGLIFAL
    USA300_FPR3757  -------------------MGVAYVFSKIQPKATIIATIALVFVALALYLVPGLGLIFAL
                                            :**************:********************

    COL             FATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSK
    N315            FATIPGIVLWNKSIQSFGVSALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSK
    NCTC8325        FATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSK
    Newman          FATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSK
    USA300_FPR3757  FATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIASLIIGQLLKERTSK
                    ******************:*****************************************

    COL             ERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILE
    N315            ERMLYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILE
    NCTC8325        ERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILE
    Newman          ERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILE
    USA300_FPR3757  ERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAITMSGADANMTQILE
                    **:*********************************************************

    COL             EGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYI
    N315            EGFRQATVQLPGFIIIITFLIVLINLIVTFPVLRKFKIATPVFKPLFAWQMSGILLWIYI
    NCTC8325        EGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYI
    Newman          EGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYI
    USA300_FPR3757  EGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKPLFAWQMSGILLWIYI
                    *******************************:****************************

    COL             IVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGT
    N315            IVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLIIGT
    NCTC8325        IVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGT
    Newman          IVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGT
    USA300_FPR3757  IVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKAKGLPNAVTILLLVIGT
                    ********************************************************:***

    COL             ILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
    N315            ILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
    NCTC8325        ILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
    Newman          ILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
    USA300_FPR3757  ILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK
                    *******************************