From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000025000
  • symbol?: rplI
  • description?: 50S ribosomal protein L9
  • strand?: +
  • coordinates?: 26247..26699
  • synteny block?: BlockID0000220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0015 (rplI)
    N315:
    SA0014 (rplI)
    NCTC8325:
    Newman:
    NWMN_0014 (rplI)
    USA300_FPR3757:
    04-02981:
    SA2981_0015 (rplI)
    08BA02176:
    C248_0015 (rplI)
    11819-97:
    MS7_0015 (rplI)
    71193:
    ST398NM01_0015
    ECT-R 2:
    ECTR2_15 (rplI)
    ED133:
    SAOV_0015 (rplI)
    ED98:
    SAAV_0017 (rplI)
    HO 5096 0412:
    SAEMRSA15_00150 (rplI)
    JH1:
    SaurJH1_0015 (rplI)
    JH9:
    SaurJH9_0015 (rplI)
    JKD6008:
    SAA6008_00015 (rplI)
    JKD6159:
    SAA6159_00015 (rplI)
    LGA251:
    SARLGA251_00150 (rplI)
    M013:
    M013TW_0016
    MRSA252:
    SAR0015 (rplI)
    MSHR1132:
    SAMSHR1132_00150
    MSSA476:
    SAS0015 (rplI)
    Mu3:
    SAHV_0015 (rplI)
    Mu50:
    SAV0015 (rplI)
    MW2:
    MW0015 (rplI)
    RF122:
    SAB0015 (rplI)
    ST398:
    SAPIG0015 (rplI)
    T0131:
    SAT0131_00017 (ndk)
    TCH60:
    HMPREF0772_10453 (rplI)
    TW20:
    SATW20_00150 (rplI)
    USA300_TCH1516:
    USA300HOU_0015 (rplI)
    VC40:
    SAVC_00075 (rplI)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVIFTQDV--KGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQER
    N315            MKVIFTQDV--KGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQER
    NCTC8325        MKVIFTQDVKGKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQER
    Newman          MKVIFTQDV--KGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQER
    USA300_FPR3757  MKVIFTQDV--KGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQER
                    *********  *************************************************

    COL             QQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLP
    N315            QQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLP
    NCTC8325        QQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLP
    Newman          QQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLP
    USA300_FPR3757  QQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLP
                    ************************************************************

    COL             NGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
    N315            NGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
    NCTC8325        NGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
    Newman          NGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
    USA300_FPR3757  NGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ
                    ******************************