From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000032000
  • symbol?: walR
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • DNA-binding response regulator YycF
    • response regulator
    • two-component response regulator
    • response regulator protein
    • transcriptional regulatory protein WalR
    • alkaline phosphatase synthesis transcriptional regulatory proteinphoP
    • response regulator receiver
    • response regulator VicR
    • response regulator WalR (YycF/VicR)
    • transcriptional regulator WalR
    • Two-component response regulator SA14-24
    • two component transcriptional regulator
  • strand?: +
  • coordinates?: 31357..32064
  • synteny block?: BlockID0000290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0019 (yycF)
    N315:
    SA0017 (vicR)
    NCTC8325:
    Newman:
    NWMN_0017 (vicR)
    USA300_FPR3757:
    04-02981:
    SA2981_0018 (vicR)
    08BA02176:
    C248_0021 (yycF)
    11819-97:
    MS7_0020 (walR)
    71193:
    ST398NM01_0020
    ECT-R 2:
    ECTR2_20
    ED133:
    SAOV_0020 (yycF)
    ED98:
    SAAV_0022 (yycF)
    HO 5096 0412:
    SAEMRSA15_00180 (yycF)
    JH1:
    SaurJH1_0018
    JH9:
    SaurJH9_0018
    JKD6008:
    SAA6008_00018 (walR)
    JKD6159:
    SAA6159_00018 (walR)
    LGA251:
    SARLGA251_00180 (yycF)
    M013:
    M013TW_0021
    MRSA252:
    SAR0018 (yycF)
    MSHR1132:
    SAMSHR1132_00190
    MSSA476:
    SAS0018
    Mu3:
    SAHV_0018 (vicR)
    Mu50:
    SAV0018 (vicR)
    MW2:
    MW0018 (vicR)
    RF122:
    SAB0018 (yycF)
    ST398:
    SAPIG0020
    T0131:
    SAT0131_00020
    TCH60:
    HMPREF0772_10450
    TW20:
    SATW20_00180 (yycF)
    USA300_TCH1516:
    USA300HOU_0018 (yycF)
    VC40:
    SAVC_00090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPG
    N315            MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPG
    NCTC8325        --MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPG
    Newman          MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPG
    USA300_FPR3757  --MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPG
                      **********************************************************

    COL             RDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLR
    N315            RDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLR
    NCTC8325        RDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLR
    Newman          RDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLR
    USA300_FPR3757  RDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLR
                    ************************************************************

    COL             RHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMT
    N315            RHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMT
    NCTC8325        RHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMT
    Newman          RHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMT
    USA300_FPR3757  RHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMT
                    ************************************************************

    COL             REHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
    N315            REHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
    NCTC8325        REHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
    Newman          REHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
    USA300_FPR3757  REHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
                    *******************************************************