From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000033000
  • symbol?: walK
  • description?: two-component sensor histidine kinase

      descriptions from strain specific annotations:

    • two-component sensor histidine kinase
    • multi-sensor signal transduction histidine kinase
    • PAS sensor protein
    • Two-component sensor kinase
    • sensory box histidine kinase YycG
    • sensor protein kinase walK
    • sensor protein YycG
    • sensor kinase protein
    • sensory box histidine kinase VicK
    • sensor histidine kinase VicK
    • sensory box histidine kinase WalK (YycG/VicK)
    • Two-component sensor kinase SA14-24
    • transcriptional regulatory protein WalK
    • multi-sensor signal transduction histidine kinase, WalK
  • strand?: +
  • coordinates?: 32077..33903
  • synteny block?: BlockID0000300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0020 (yycG)
    N315:
    SA0018 (vicK)
    NCTC8325:
    Newman:
    NWMN_0018 (vicK)
    USA300_FPR3757:
    04-02981:
    SA2981_0019 (vicK)
    08BA02176:
    C248_0022 (yycG)
    11819-97:
    MS7_0021 (walK)
    71193:
    ST398NM01_0021
    ECT-R 2:
    ECTR2_21
    ED133:
    SAOV_0021 (yycG)
    ED98:
    SAAV_0023 (yycG)
    HO 5096 0412:
    SAEMRSA15_00190 (yycG)
    JH1:
    SaurJH1_0019
    JH9:
    SaurJH9_0019
    JKD6008:
    SAA6008_00019 (walK)
    JKD6159:
    SAA6159_00019 (walK)
    LGA251:
    SARLGA251_00190 (walK)
    M013:
    M013TW_0022
    MRSA252:
    SAR0019 (yycG)
    MSHR1132:
    SAMSHR1132_00200
    MSSA476:
    SAS0019
    Mu3:
    SAHV_0019 (vicK)
    Mu50:
    SAV0019 (vicK)
    MW2:
    MW0019 (vicK)
    RF122:
    SAB0019 (yycG)
    ST398:
    SAPIG0021
    T0131:
    SAT0131_00021 (hup)
    TCH60:
    HMPREF0772_10449
    TW20:
    SATW20_00190 (yycG)
    USA300_TCH1516:
    USA300HOU_0019
    VC40:
    SAVC_00095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI
    N315            MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI
    NCTC8325        MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI
    Newman          MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI
    USA300_FPR3757  MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISI
                    ************************************************************

    COL             EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS
    N315            EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS
    NCTC8325        EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS
    Newman          EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS
    USA300_FPR3757  EKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDS
                    ************************************************************

    COL             SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI
    N315            SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI
    NCTC8325        SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI
    Newman          SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI
    USA300_FPR3757  SVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNI
                    ************************************************************

    COL             NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL
    N315            NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL
    NCTC8325        NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL
    Newman          NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL
    USA300_FPR3757  NQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGEL
                    ************************************************************

    COL             ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAK
    N315            ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAK
    NCTC8325        ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAK
    Newman          ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMFGMAK
    USA300_FPR3757  ALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAK
                    *******************************************************:****

    COL             EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI
    N315            EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI
    NCTC8325        EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI
    Newman          EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI
    USA300_FPR3757  EDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYI
                    ************************************************************

    COL             AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR
    N315            AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR
    NCTC8325        AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR
    Newman          AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR
    USA300_FPR3757  AVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTR
                    ************************************************************

    COL             EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK
    N315            EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK
    NCTC8325        EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK
    Newman          EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK
    USA300_FPR3757  EETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKK
                    ************************************************************

    COL             TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK
    N315            TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK
    NCTC8325        TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK
    Newman          TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK
    USA300_FPR3757  TIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINK
                    ************************************************************

    COL             VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV
    N315            VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV
    NCTC8325        VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV
    Newman          VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV
    USA300_FPR3757  VDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEV
                    ************************************************************

    COL             IEDGDWDE
    N315            IEDGDWDE
    NCTC8325        IEDGDWDE
    Newman          IEDGDWDE
    USA300_FPR3757  IEDGDWDE
                    ********