From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000040000
  • symbol?: orfX
  • description?: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH

      descriptions from strain specific annotations:

    • 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH
    • rRNA large subunit methyltransferase
    • alpha/beta knot family protein
    • LSU m3Psi1915 methyltransferase RlmH
    • LSU m3Psi1915 methyltransferase RlmH ybeA
    • ribosomal RNA large subunit methyltransferase H
    • rRNA large subunit m3Psi methyltransferase RlmH
  • strand?: +
  • coordinates?: 40139..40622
  • synteny block?: BlockID0000370
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0023 (orfX)
    NCTC8325:
    Newman:
    NWMN_0023 (orfX)
    USA300_FPR3757:
    04-02981:
    SA2981_0024 (orfX)
    08BA02176:
    C248_0027
    11819-97:
    MS7_0026 (rlmH)
    71193:
    ST398NM01_0027
    ECT-R 2:
    ECTR2_27
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00240
    JH1:
    SaurJH1_0024
    JH9:
    SaurJH9_0024
    JKD6008:
    SAA6008_00025
    JKD6159:
    SAA6159_00024
    LGA251:
    SARLGA251_00240
    M013:
    M013TW_0027
    MRSA252:
    SAR0024
    MSHR1132:
    SAMSHR1132_00250
    MSSA476:
    SAS0024
    Mu3:
    SAHV_0024
    Mu50:
    SAV0024
    MW2:
    MW0024 (orfX)
    RF122:
    SAB0024
    ST398:
    SAPIG0027
    T0131:
    SAT0131_00027 (cmk)
    TCH60:
    HMPREF0772_10443
    TW20:
    SATW20_00250
    USA300_TCH1516:
    USA300HOU_0024 (orfX)
    VC40:
    SAVC_00120

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEG
    NCTC8325        MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEG
    Newman          MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEG
    USA300_FPR3757  MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEG
                    ************************************************************

    N315            QRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQR
    NCTC8325        QRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQR
    Newman          QRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQR
    USA300_FPR3757  QRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQR
                    ************************************************************

    N315            SNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
    NCTC8325        SNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
    Newman          SNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
    USA300_FPR3757  SNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
                    ***************************************