From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000097000
  • symbol?: mvaS2
  • description?: HMG-CoA synthase, truncation

      descriptions from strain specific annotations:

    • HMG-CoA synthase, truncation
    • 3-hydroxy-3-methylglutaryl CoA synthase
    • HMG-CoA synthase
    • HMG-CoA synthase (partial)
    • Hydroxymethylglutaryl-CoA synthase N-domain protein
    • probable HMG-CoA synthase
    • pseudogene
    • putative Hmg-CoA synthase
  • strand?: +
  • coordinates?: 109669..109836
  • synteny block?: BlockID0000750
  • occurrence?: in 41% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_0030 (mvaS2)
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_00036
    JKD6159:
    SAA6159_00028
    LGA251:
    M013:
    M013TW_0042
    MRSA252:
    SAR0035
    MSHR1132:
    SAMSHR1132_00290
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    MW0028
    RF122:
    ST398:
    SAPIG0039
    T0131:
    SAT0131_00031 (ebpS)
    TCH60:
    HMPREF0772_10439
    TW20:
    SATW20_00700
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK
    USA300_FPR3757  MLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK
                    *******************************************************