From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000099000
  • symbol?: ugpQ
  • description?: glycerophosphoryl diester phosphodiesterase

      descriptions from strain specific annotations:

    • glycerophosphoryl diester phosphodiesterase
    • putative glycerophosphoryl diester phosphodiesterase
    • glycerophosphodiester phosphodiesterase
    • glycerophosphoryl diester phosphodiesterase, UgpQ_1
    • glycerophosphoryl diester phosphodiesterase family protein
    • glycerophosphoryl diester phosphodiesterase-like protein
  • strand?: +
  • coordinates?: 115283..117131
  • synteny block?: BlockID0000770
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0037
    08BA02176:
    C248_0034 (ugpQ)
    11819-97:
    MS7_0031
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00290 (ugpQ)
    JH1:
    SaurJH1_0027
    JH9:
    SaurJH9_0027
    JKD6008:
    SAA6008_00037 (ugpQ_1)
    JKD6159:
    SAA6159_00029 (ugpQ_1)
    LGA251:
    M013:
    M013TW_0043
    MRSA252:
    SAR0037 (ugpQ)
    MSHR1132:
    SAMSHR1132_00300
    MSSA476:
    Mu3:
    SAHV_0038
    Mu50:
    SAV0039
    MW2:
    MW0029
    RF122:
    ST398:
    SAPIG0040
    T0131:
    SAT0131_00032
    TCH60:
    HMPREF0772_10437 (glpQ2)
    TW20:
    SATW20_00720 (ugpQ)
    USA300_TCH1516:
    USA300HOU_0029 (ugpQ1)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNM
    N315            MLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNM
    USA300_FPR3757  MLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNM
                    ************************************************************

    COL             SGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGL
    N315            SGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGL
    USA300_FPR3757  SGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGL
                    ************************************************************

    COL             ALSKSMVKQVEEQLTNLNQNQEVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRT
    N315            ALSKSMVKQVEEQLTNLNQNQEVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRT
    USA300_FPR3757  ALSKSMVKQVEEQLTNLNQNQEVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRT
                    ************************************************************

    COL             LLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNAD
    N315            LLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNAD
    USA300_FPR3757  LLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNAD
                    ************************************************************

    COL             KMVHLSQ
    N315            KMVHLSQ
    USA300_FPR3757  KMVHLSQ
                    *******