From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000100000
  • symbol?: maoC
  • description?: MaoC domain-containing protein

      descriptions from strain specific annotations:

    • MaoC domain-containing protein
    • acyl dehydratase MaoC
    • dehydratase
    • MaoC domain-containing protein dehydratase
    • MaoC like domain, putative
    • maoC like domain protein
  • strand?: +
  • coordinates?: 117228..118527
  • synteny block?: BlockID0000780
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0032 (maoC)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0038
    08BA02176:
    C248_0035 (maoC)
    11819-97:
    MS7_0032
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00300
    JH1:
    SaurJH1_0028
    JH9:
    SaurJH9_0028
    JKD6008:
    SAA6008_00038 (maoC)
    JKD6159:
    SAA6159_00030 (maoC)
    LGA251:
    M013:
    M013TW_0044
    MRSA252:
    SAR0038
    MSHR1132:
    SAMSHR1132_00310
    MSSA476:
    Mu3:
    SAHV_0039
    Mu50:
    SAV0040
    MW2:
    MW0030
    RF122:
    ST398:
    SAPIG0041
    T0131:
    SAT0131_00033
    TCH60:
    HMPREF0772_10436 (maoC)
    TW20:
    SATW20_00730
    USA300_TCH1516:
    USA300HOU_0030 (maoC)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLS
    N315            MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLS
    USA300_FPR3757  MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLS
                    ************************************************************

    COL             ISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSL
    N315            ISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSL
    USA300_FPR3757  ISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSL
                    ************************************************************

    COL             STYNENEEIVFKGEVTALINNS
    N315            STYNENEEIVFKGEVTALINNS
    USA300_FPR3757  STYNENEEIVFKGEVTALINNS
                    **********************