From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000103000
  • symbol?: rplL
  • description?: type I restriction endonuclease

      descriptions from strain specific annotations:

    • type I restriction endonuclease
    • 50S ribosomal protein L7/L12
    • pseudogene
    • type I site-specific deoxyribonuclease restriction subunit
  • strand?: +
  • coordinates?: 122711..125384
  • synteny block?: BlockID0000810
  • occurrence?: in 28% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_0035
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00321
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_00033
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_00340
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    MW0033 (hsdR)
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10433 (rplL)
    TW20:
    USA300_TCH1516:
    USA300HOU_0033 (hsdR1)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYVVYRASHETAKEALGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKK
    USA300_FPR3757  ---------------MGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKK
                                   :********************************************

    COL             YGYPPDLQKMAVEQVVEQAELMASQQ
    USA300_FPR3757  YGYPPDLQKMAVEQVVEQAELMASQQ
                    **************************