From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000110000
  • symbol?:
  • description?: rhodanese domain-containing protein

      descriptions from strain specific annotations:

    • rhodanese domain-containing protein
    • rhodanese-like domain-containing protein
    • coenzyme A disulfide reductase/ disulfide bond regulator domain
  • strand?: -
  • coordinates?: 128902..129966
  • synteny block?: BlockID0000880
  • occurrence?: in 38% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0046
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_0035
    JH9:
    SaurJH9_0035
    JKD6008:
    SAA6008_00045
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0046
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0046
    Mu50:
    SAV0047
    MW2:
    RF122:
    ST398:
    SAPIG0062
    T0131:
    SAT0131_00040
    TCH60:
    TW20:
    SATW20_00790
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQYKTKHINDFTKKELQELSSKGQLIDVRHPEEFELGHIKNALLHSVENIETFKQSKNK
    N315            MEQYKEVHINSLNKEELEKLAKMGQLIDVRTKEEYELGHINGSTLHPVEEIKSFNKNSNK
                    *.***  ***.:.*:**::*:. *******  **:*****:.: **.**:*::*::..**

    COL             TYYIYCKSGNRSRKASQFLAQRGYDVVNLDGGYTAYEQQHHNDNLSKVKEDREIKDNRKT
    N315            TYYIHCKSGNRSTKACDYLAKQGYDVVNLKGGYKDYEAKNFN-SAPLIEKDIEIKENRKQ
                    ****:******* **.::**::*******.***. ** ::.* . . :::* ***:*** 

    COL             FNYSNLQCPGPIVNISKEIKNIAIGDQIEVVVTDHGFLNDIKSWVKQTGHTLVRLNDFGN
    N315            FDFRGLQCPGPIVNISKEINNISTGEQIEVTVTDPGFNSDIKSWAKQTGNTLVNLTEEAN
                    *:: .**************:**: *:****.*** ** .*****.****:***.*.: .*

    COL             EIRAIIQKEENKNIEVTHTKSGTTIVLFSGELDKAVAAMIIANGAKAAGRDVTIFCTFWG
    N315            VINAIIQKEKPKEFEINDTATGTTIVLFSGELDKAVAAMIIANGAKAAGKDVTIFFTFWG
                     *.******: *::*:..* :****************************:***** ****

    COL             LNALKKIQSQRIKKKGIAKLFDFMLPNSPINMPISKMNMFGLGNLMMRYVMKKKNVDTLP
    N315            LNALKKAQSTRVKKKGISKMFDLMLPKDPIHMPLSKMNMFGLGNIMMRYVMNKKNVDSLY
                    ****** ** *:*****:*:**:***:.**:**:**********:******:*****:* 

    COL             SLIDQAVEQGVKLIACTMSMDVMGITKEELRDDVEYGGVGAYIGYTEQANHNLFI
    N315            SLIDQAIDQDIKLIACTMSMDVMGISKEELRDEVDYGGVGTYIGHTEQANHNLFI
                    ******::*.:**************:******:*:*****:***:**********